• Gene id: 6277

Gene Summary

• Gene Symbol: S100A6   Gene   UCSC   Ensembl
• Aliases: 2A9, 5B10, CABP, CACY, PRA, S10A6
• Gene name: S100 calcium binding protein A6
• Alternate names: protein S100-A6, MLN 4, calcyclin, growth factor-inducible protein 2A9, prolactin receptor-associated protein,
• Gene location: 1q21.3 (50842925: 50887883)     Exons: 5     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 114110

Protein Summary

• Protein general information: P06703  
  • Name: Protein S100 A6 (Calcyclin) (Growth factor inducible protein 2A9) (MLN 4) (Prolactin receptor associated protein) (PRA) (S100 calcium binding protein A6)
  • Length: 90  
  • Mass: 10180
• Sequence:

  MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVT
  FLGALALIYNEALKG

• Structural information:
  • Protein Domains: (12..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (48..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR034118  IPR001751   IPR013787  
  • Prosite: PS00018 PS50222 PS00303
  • CDD: cd05029
  • PDB: 1K8U 1K96 1K9K 1K9P 2M1K 4YBH
  • PDBsum: 1K8U 1K96 1K9K 1K9P 2M1K 4YBH
  • STRING: ENSP00000357709
• Other Databases: GeneCards:  S100A6  Malacards:  S100A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0005523	tropomyosin binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0015075	ion transmembrane transporter activity	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0048146	positive regulation of fibroblast proliferation	NAS	biological process
GO:0007409	axonogenesis	NAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005509	calcium ion binding	NAS	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0005635	nuclear envelope	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881