• Gene id: 6276

Gene Summary

• Gene Symbol: S100A5   Gene   UCSC   Ensembl
• Aliases: S100D
• Gene name: S100 calcium binding protein A5
• Alternate names: protein S100-A5,
• Gene location: 1q21.3 (153543513: 153537113)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 176991

Protein Summary

• Protein general information: P33763  
  • Name: Protein S100 A5 (Protein S 100D) (S100 calcium binding protein A5)
  • Length: 92  
  • Mass: 10744
• Sequence:

  METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVF
  LTMLCMAYNDFFLEDNK

• Structural information:
  • Protein Domains: (12..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (47..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR034325  IPR028497   IPR001751  IPR013787  
  • Prosite: PS00018 PS50222 PS00303
  • CDD: cd00213
  • PDB: 2KAX 2KAY 4DIR
  • PDBsum: 2KAX 2KAY 4DIR
  • STRING: ENSP00000357707
• Other Databases: GeneCards:  S100A5  Malacards:  S100A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046914	transition metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881