• Gene id: 6275

Gene Summary

• Gene Symbol: S100A4   Gene   UCSC   Ensembl
• Aliases: 18A2, 42A, CAPL, FSP1, MTS1, P9KA, PEL98
• Gene name: S100 calcium binding protein A4
• Alternate names: protein S100-A4, S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog), calcium placental protein, fibroblast-specific protein-1, leukemia multidrug resistance associated protein, malignant transformation suppress,
• Gene location: 1q21.3 (153658653: 153661851)     Exons: 4     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 114210

Protein Summary

• Protein general information: P26447  
  • Name: Protein S100 A4 (Calvasculin) (Metastasin) (Placental calcium binding protein) (Protein Mts1) (S100 calcium binding protein A4)
  • Length: 101  
  • Mass: 11729
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEY
  CVFLSCIAMMCNEFFEGFPDKQPRKK

• Structural information:
  • Protein Domains: (12..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (50..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR034325  IPR001751   IPR013787  
  • Prosite: PS00018 PS50222 PS00303
  • CDD: cd00213
  • PDB: 1M31 2LNK 2MRD 2Q91 3C1V 3CGA 3KO0 3M0W 3ZWH 4CFQ 4CFR 4ETO 4HSZ 5LPU
  • PDBsum: 1M31 2LNK 2MRD 2Q91 3C1V 3CGA 3KO0 3M0W 3ZWH 4CFQ 4CFR 4ETO 4HSZ 5LPU
  • DIP: 44938
  • STRING: ENSP00000357705
• Other Databases: GeneCards:  S100A4  Malacards:  S100A4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001837	epithelial to mesenchymal transition	TAS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046914	transition metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R