• Gene id: 6259

Gene Summary

• Gene Symbol: RYK   Gene   UCSC   Ensembl
• Aliases: D3S3195, JTK5, JTK5A, RYK1
• Gene name: receptor like tyrosine kinase
• Alternate names: tyrosine-protein kinase RYK, JTK5A protein tyrosine kinase, hydroxyaryl-protein kinase,
• Gene location: 3q22.2 (134250858: 134157132)     Exons: 15     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product bel
• OMIM: 600524

Protein Summary

• Protein general information: P34925  
  • Name: Tyrosine protein kinase RYK (EC 2.7.10.1)
  • Length: 607  
  • Mass: 67815
  • Tissue specificity: Observed in all the tissues examined.
• Sequence:

  MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSEDEVRR
  LIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTL
  SVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTS
  TRVFYISVGVCCAVIFLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSYPT
  LRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQAFVKTVKDQASEIQV
  TMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLKLFLRQCKLVEANNPQAISQQDLVHMAIQIA
  CGMSYLARREVIHKDLAARNCVIDDTLQVKITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDV
  WAFGVTLWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFH
  AALGAYV

• Structural information:
  • Protein Domains: (66..19-)
    (/note="WIF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00222-)
    (330..60-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR001245  IPR008266  IPR003306   IPR038677  
  • Prosite: PS50011 PS00109 PS50814
  • PDB: 6TUA
  • PDBsum: 6TUA
  • STRING: ENSP00000478721
• Other Databases: GeneCards:  RYK  Malacards:  RYK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042813	Wnt-activated receptor activity	ISS	molecular function
GO:0035567	non-canonical Wnt signaling pathway	NAS	biological process
GO:0005109	frizzled binding	ISS	molecular function
GO:0005109	frizzled binding	NAS	molecular function
GO:1904938	planar cell polarity pathway involved in axon guidance	ISS	biological process
GO:0017147	Wnt-protein binding	ISS	molecular function
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0071679	commissural neuron axon guidance	ISS	biological process
GO:0022008	neurogenesis	NAS	biological process
GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway	TAS	molecular function
GO:0007409	axonogenesis	TAS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0007411	axon guidance	NAS	biological process
GO:0007416	synapse assembly	NAS	biological process
GO:0036518	chemorepulsion of dopaminergic neuron axon	ISS	biological process
GO:1904948	midbrain dopaminergic neuron differentiation	ISS	biological process
GO:1904953	Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	TAS	biological process
GO:1904953	Wnt signaling pathway involved in midbrain dopaminergic neuron differentiation	ISS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0060070	canonical Wnt signaling pathway	NAS	biological process
GO:0033278	cell proliferation in midbrain	ISS	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	NOT|molecular function
GO:0007409	axonogenesis	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0031175	neuron projection development	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0022038	corpus callosum development	ISS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0007411	axon guidance	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:1904948	midbrain dopaminergic neuron differentiation	IEA	biological process
GO:0050919	negative chemotaxis	IEA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IEA	biological process
GO:0036518	chemorepulsion of dopaminergic neuron axon	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0022038	corpus callosum development	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005109	frizzled binding	IEA	molecular function
GO:1904938	planar cell polarity pathway involved in axon guidance	IEA	biological process
GO:0071679	commissural neuron axon guidance	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0042813	Wnt-activated receptor activity	IEA	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IDA	NOT|molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0006468	protein phosphorylation	IDA	NOT|biological process
GO:0004888	transmembrane signaling receptor activity	IDA	molecular function
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)