• Gene id: 6249

Gene Summary

• Gene Symbol: CLIP1   Gene   UCSC   Ensembl
• Aliases: CLIP, CLIP-170, CLIP170, CYLN1, RSN
• Gene name: CAP-Gly domain containing linker protein 1
• Alternate names: CAP-Gly domain-containing linker protein 1, cytoplasmic linker protein 1, cytoplasmic linker protein 170 alpha-2, cytoplasmic linker protein CLIP-170, restin (Reed-Steinberg cell-expressed intermediate filament-associated protein),
• Gene location: 12q24.31 (122422955: 122271430)     Exons: 30     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene links endocytic vesicles to microtubules. This gene is highly expressed in Reed-Sternberg cells of Hodgkin disease. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• OMIM: 179838

Protein Summary

• Protein general information: P30622  
  • Name: CAP Gly domain containing linker protein 1 (Cytoplasmic linker protein 1) (Cytoplasmic linker protein 170 alpha 2) (CLIP 170) (Reed Sternberg intermediate filament associated protein) (Restin)
  • Length: 1438  
  • Mass: 162246
  • Tissue specificity: Detected in dendritic cells (at protein level). Highly expressed in the Reed-Sternberg cells of Hodgkin disease. {ECO
• Sequence:

  MSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQ
  FLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVQAEDEANGLQTTPASRATSPLC
  TSTASMVSSSPSTPSNIPQKPSQPAAKEPSATPPISNLTKTASESISNLSEAGSIKKGERELKIGDRVLVGGTKA
  GVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKANAVRRVM
  ATTSASLKRSPSASSLSSMSSVASSVSSRPSRTGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLER
  AEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAADREKVELLNQLEEEKRKVEDLQFRVEEESI
  TKGDLEQKSQISEDPENTQTKLEHARIKELEQSLLFEKTKADKLQRELEDTRVATVSEKSRIMELEKDLALRVQE
  VAELRRRLESNKPAGDVDMSLSLLQEISSLQEKLEVTRTDHQREITSLKEHFGAREETHQKEIKALYTATEKLSK
  ENESLKSKLEHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSKGLGTETAEFAELKTQIEKMRLDYQHEIE
  NLQNQQDSERAAHAKEMEALRAKLMKVIKEKENSLEAIRSKLDKAEDQHLVEMEDTLNKLQEAEIKVKELEVLQA
  KCNEQTKVIDNFTSQLKATEEKLLDLDALRKASSEGKSEMKKLRQQLEAAEKQIKHLEIEKNAESSKASSITREL
  QGRELKLTNLQENLSEVSQVKETLEKELQILKEKFAEASEEAVSVQRSMQETVNKLHQKEEQFNMLSSDLEKLRE
  NLADMEAKFREKDEREEQLIKAKEKLENDIAEIMKMSGDNSSQLTKMNDELRLKERDVEELQLKLTKANENASFL
  QKSIEDMTVKAEQSQQEAAKKHEEEKKELERKLSDLEKKMETSHNQCQELKARYERATSETKTKHEEILQNLQKT
  LLDTEDKLKGAREENSGLLQELEELRKQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQNELDT
  LKENNLKNVEELNKSKELLTVENQKMEEFRKEIETLKQAAAQKSQQLSALQEENVKLAEELGRSRDEVTSHQKLE
  EERSVLNNQLLEMKKRESKFIKDADEEKASLQKSISITSALLTEKDAELEKLRNEVTVLRGENASAKSLHSVVQT
  LESDKVKLELKVKNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEA
  ALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMF
  GHWATNCNDDETF

• Structural information:
  • Protein Domains: (78..12-)
    (/note="CAP-Gly-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045-)
    (232..27-)
    (/note="CAP-Gly-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00045"-)
  • Interpro: IPR036859  IPR000938  IPR032108  
  • Prosite: PS00845 PS50245
  • PDB: 2CP5 2CP6 2E3H 2E3I 2E4H 2HQH 2QK0 3E2U 3RDV
  • PDBsum: 2CP5 2CP6 2E3H 2E3I 2E4H 2HQH 2QK0 3E2U 3RDV
  • DIP: 42826
  • STRING: ENSP00000479322
• Other Databases: GeneCards:  CLIP1  Malacards:  CLIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005938	cell cortex	IBA	cellular component
GO:0031116	positive regulation of microtubule polymerization	IBA	biological process
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0051010	microtubule plus-end binding	IBA	molecular function
GO:0044354	macropinosome	IDA	colocalizes with
GO:0015631	tubulin binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0051010	microtubule plus-end binding	IDA	molecular function
GO:0035371	microtubule plus-end	IDA	colocalizes with
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:0015630	microtubule cytoskeleton	IMP	cellular component
GO:0005874	microtubule	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001578	microtubule bundle formation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005882	intermediate filament	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0044861	protein transport into plasma membrane raft	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0051010	microtubule plus-end binding	IEA	molecular function
GO:0035371	microtubule plus-end	IEA	cellular component
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005874	microtubule	IMP	cellular component
GO:0000776	kinetochore	TAS	cellular component
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Role in shaping the sperm nucleus	MIK: 11476580
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R