• Gene id: 6242

Gene Summary

• Gene Symbol: RTKN   Gene   UCSC   Ensembl
• Gene name: rhotekin
• Alternate names: rhotekin,
• Gene location: 2p13.1 (74441936: 74425834)     Exons: 16     NC_000002.12
• Gene summary(Entrez): This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form b
• OMIM: 600387

Protein Summary

• Protein general information: Q9BST9  
  • Name: Rhotekin
  • Length: 563  
  • Mass: 62667
  • Tissue specificity: Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all norm
• Sequence:

  MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLPEDTELQRKLDHEIRMREGACKLLAACSQREQALEATKSL
  LVCNSRILSYMGELQRRKEAQVLGKTSRRPSDSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVF
  LLLQLGEHIQDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGACVEEEGALTGGPKRLATKLSSSLGRSS
  GRRVRASLDSAGGSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLASHEENPAWLPLYGSVCCRL
  AAQPLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQAL
  GRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPAPRKPPQALAKQGSLY
  HEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVP
  PDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV

• Structural information:
  • Protein Domains: (17..9-)
    (/note="REM-1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (309..41-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR012966  IPR011072  IPR011993  IPR001849  IPR030471  
  • Prosite: PS50003 PS51860
  • DIP: 31098
  • STRING: ENSP00000272430
• Other Databases: GeneCards:  RTKN  Malacards:  RTKN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:1904498	protein localization to mitotic actomyosin contractile ring	IBA	biological process
GO:0031106	septin ring organization	IBA	biological process
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0005826	actomyosin contractile ring	IBA	cellular component
GO:0005095	GTPase inhibitor activity	IBA	molecular function
GO:0000915	actomyosin contractile ring assembly	IBA	biological process
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0032185	septin cytoskeleton organization	IEA	biological process
GO:0017049	GTP-Rho binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017048	Rho GTPase binding	IEA	molecular function
GO:0005095	GTPase inhibitor activity	IEA	molecular function
GO:0017049	GTP-Rho binding	IEA	molecular function
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0007165	signal transduction	IDA	biological process
GO:0042981	regulation of apoptotic process	IDA	biological process
GO:0017049	GTP-Rho binding	IDA	molecular function
GO:0005095	GTPase inhibitor activity	IDA	molecular function
GO:0007266	Rho protein signal transduction	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
hepatocellular carcinoma	PMID:27922690
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R