• Gene id: 6241

Gene Summary

• Gene Symbol: RRM2   Gene   UCSC   Ensembl
• Aliases: C2orf48, R2, RR2, RR2M
• Gene name: ribonucleotide reductase regulatory subunit M2
• Alternate names: ribonucleoside-diphosphate reductase subunit M2, ribonucleotide reductase M2 polypeptide, ribonucleotide reductase small chain, ribonucleotide reductase small subunit, uncharacterized protein C2orf48,
• Gene location: 2p25.1 (10122567: 10211009)     Exons: 14     NC_000002.12
• Gene summary(Entrez): This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Tr
• OMIM: 180390

Protein Summary

• Protein general information: P31350  
  • Name: Ribonucleoside diphosphate reductase subunit M2 (EC 1.17.4.1) (Ribonucleotide reductase small chain) (Ribonucleotide reductase small subunit)
  • Length: 389  
  • Mass: 44878
• Sequence:

  MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRE
  NPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFS
  QEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERV
  VAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
  QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVM
  SSPTENSFTLDADF

• Structural information:
  • Interpro: IPR009078  IPR012348  IPR033909  IPR030475  IPR000358  
  • Prosite: PS00368
  • CDD: cd01049
  • PDB: 2UW2 3OLJ 3VPM 3VPN 3VPO
  • PDBsum: 2UW2 3OLJ 3VPM 3VPN 3VPO
  • DIP: 24232
  • STRING: ENSP00000353770
• Other Databases: GeneCards:  RRM2  Malacards:  RRM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004748	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0009263	deoxyribonucleotide biosynthetic process	IBA	biological process
GO:0004748	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	ISS	molecular function
GO:0009263	deoxyribonucleotide biosynthetic process	ISS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0009263	deoxyribonucleotide biosynthetic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004748	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IEA	molecular function
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0070317	negative regulation of G0 to G1 transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0008199	ferric iron binding	IEA	molecular function
GO:0005971	ribonucleoside-diphosphate reductase complex	IEA	cellular component
GO:0004748	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IEA	molecular function
GO:0051290	protein heterotetramerization	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0009263	deoxyribonucleotide biosynthetic process	IEA	biological process
GO:0009262	deoxyribonucleotide metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0004748	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism
hsa04115	p53 signaling pathway
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
urinary bladder cancer	PMID:21139803
pancreatic cancer	PMID:19568409
Breast carcinoma	PMID:21556566
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881