• Gene id: 624

Gene Summary

• Gene Symbol: BDKRB2   Gene   UCSC   Ensembl
• Aliases: B2R, BK-2, BK2, BKR2, BRB2
• Gene name: bradykinin receptor B2
• Alternate names: B2 bradykinin receptor, BK-2 receptor,
• Gene location: 14q32.2 (96204797: 96244328)     Exons: 3     NC_000014.9
• Gene summary(Entrez): This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. Bradykinin is released upon activation by pathophysiologic conditions such as tr
• OMIM: 113503

Protein Summary

• Protein general information: P30411  
  • Name: B2 bradykinin receptor (B2R) (BK 2 receptor)
  • Length: 391  
  • Mass: 44461
  • Tissue specificity: Ubiquitous. Widespread in normal smooth muscle tissue and neurons. {ECO
• Sequence:

  MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQPPFLWVLFVLATLEN
  IFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSICFLML
  VSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTN
  MLLNVVGFLLPLSVITFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
  LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSIS
  VERQIHKLQDWAGSRQ

• Structural information:
  • Interpro: IPR001504  IPR000496  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000450482
• Other Databases: GeneCards:  BDKRB2  Malacards:  BDKRB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004947	bradykinin receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004947	bradykinin receptor activity	IEA	molecular function
GO:0006939	smooth muscle contraction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042310	vasoconstriction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004435	phosphatidylinositol phospholipase C activity	TAS	molecular function
GO:0004947	bradykinin receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0008015	blood circulation	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1902239	negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress by p53 class mediator	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0009651	response to salt stress	IEA	biological process
GO:1902219	negative regulation of intrinsic apoptotic signaling pathway in response to osmotic stress	IEA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0004947	bradykinin receptor activity	IDA	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0031702	type 1 angiotensin receptor binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0006939	smooth muscle contraction	IC	biological process
GO:0043114	regulation of vascular permeability	IC	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0006954	inflammatory response	IC	biological process
GO:0019229	regulation of vasoconstriction	IC	biological process
GO:0050482	arachidonic acid secretion	IDA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04080	Neuroactive ligand-receptor interaction
hsa04810	Regulation of actin cytoskeleton
hsa04020	Calcium signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa05142	Chagas disease
hsa04610	Complement and coagulation cascades
hsa04961	Endocrine and other factor-regulated calcium reabsorption

Diseases

Associated diseases	References
Hypertension	PMID:10904024
Asthma	PMID:19038786
Asthma	PMID:8856156
Chronic obstructive pulmonary disease	PMID:16600946
Diabetic retinopathy	PMID:18311190
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray