• Gene id: 6237

Gene Summary

• Gene Symbol: RRAS   Gene   UCSC   Ensembl
• Aliases: R-Ras
• Gene name: RAS related
• Alternate names: ras-related protein R-Ras, oncogene RRAS, p23, ras family small GTP binding protein R-Ras, related RAS viral (r-ras) oncogene homolog,
• Gene location: 19q13.33 (154781248: 154828812)     Exons: 11     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided
• OMIM: 165090

Protein Summary

• Protein general information: P10301  
  • Name: Ras related protein R Ras (p23)
  • Length: 218  
  • Mass: 23480
• Sequence:

  MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGI
  PARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVGKLFTQILRVKDRDDFPVVLVGNKADLESQR
  QVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 2FN4
  • PDBsum: 2FN4
  • STRING: ENSP00000246792
• Other Databases: GeneCards:  RRAS  Malacards:  RRAS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001214	positive regulation of vasculogenesis	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:1904906	positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0002521	leukocyte differentiation	IMP	biological process
GO:0060325	face morphogenesis	IMP	biological process
GO:0003924	GTPase activity	IMP	molecular function
GO:0019003	GDP binding	IMP	molecular function
GO:0051896	regulation of protein kinase B signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04218	Cellular senescence
hsa04625	C-type lectin receptor signaling pathway
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881