• Gene id: 6236

Gene Summary

• Gene Symbol: RRAD   Gene   UCSC   Ensembl
• Aliases: RAD, RAD1, REM3
• Gene name: RRAD, Ras related glycolysis inhibitor and calcium channel regulator
• Alternate names: GTP-binding protein RAD, RAS (RAD and GEM) like GTP binding 3, RRAD, Ras related glycolysis inihibitor and calcium channel regulator, Ras-related associated with diabetes, ras associated with diabetes,
• Gene location: 16q22.1 (66925535: 66921678)     Exons: 5     NC_000016.10
• OMIM: 600163

Protein Summary

• Protein general information: P55042  
  • Name: GTP binding protein RAD (RAD1) (Ras associated with diabetes)
  • Length: 308  
  • Mass: 33245
  • Tissue specificity: Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. {ECO
• Sequence:

  MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPED
  SEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDG
  GRWLPGHCMAMGDAYVIVYSVTDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVF
  DCKFIETSAALHHNVQALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK
  SCHDLSVL

• Structural information:
  • Interpro: IPR027417  IPR028869  IPR017358  IPR005225  IPR001806   IPR020849  
  • Prosite: PS51421
  • PDB: 2DPX 2GJS 3Q72 3Q7P 3Q7Q
  • PDBsum: 2DPX 2GJS 3Q72 3Q7P 3Q7Q
  • STRING: ENSP00000299759
• Other Databases: GeneCards:  RRAD  Malacards:  RRAD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005246	calcium channel regulator activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:1901841	regulation of high voltage-gated calcium channel activity	IEA	biological process
GO:1901842	negative regulation of high voltage-gated calcium channel activity	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
congestive heart failure	PMID:18056528
type 2 diabetes mellitus	PMID:10024077
type 2 diabetes mellitus	PMID:15161552
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq