• Gene id: 6199

Gene Summary

• Gene Symbol: RPS6KB2   Gene   UCSC   Ensembl
• Aliases: KLS, P70-beta, P70-beta-1, P70-beta-2, S6K-beta2, S6K2, S6KB, S6KI(2), S6Kbeta, SRK, STK14B, p70(S6K)-beta, p70S6Kb
• Gene name: ribosomal protein S6 kinase B2
• Alternate names: ribosomal protein S6 kinase beta-2, 70 kDa ribosomal protein S6 kinase 2, P70S6K2, S6 kinase-related kinase, S6K-beta, S6K-beta-2, p70 S6 kinase beta, p70 S6K-beta, p70 S6KB, p70 ribosomal S6 kinase beta, p70-S6K 2, ribosomal protein S6 kinase, 70kDa, polypeptide 2, ,
• Gene location: 11q13.2 (67428474: 67435407)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphoryla
• OMIM: 608939

Protein Summary

• Protein general information: Q9UBS0  
  • Name: Ribosomal protein S6 kinase beta 2 (S6K beta 2) (S6K2) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 2) (P70S6K2) (p70 S6K 2) (S6 kinase related kinase) (SRK) (Serine/threonine protein kinase 14B) (p70 ribosomal S6 kinase beta) (S6K beta) (p70 S6 kina
  • Length: 482  
  • Mass: 53455
• Sequence:

  MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGK
  GGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILEC
  LSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAV
  THTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
  KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTA
  LSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPL
  LPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR

• Structural information:
  • Protein Domains: (67..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (329..39-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR016238  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • STRING: ENSP00000308413
• Other Databases: GeneCards:  RPS6KB2  Malacards:  RPS6KB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004711	ribosomal protein S6 kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0045948	positive regulation of translational initiation	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006412	translation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0004711	ribosomal protein S6 kinase activity	IEA	molecular function
GO:0043491	protein kinase B signaling	IEA	biological process
GO:0042277	peptide binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa05163	Human cytomegalovirus infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04152	AMPK signaling pathway
hsa05231	Choline metabolism in cancer
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04066	HIF-1 signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa01522	Endocrine resistance
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05221	Acute myeloid leukemia
hsa04213	Longevity regulating pathway - multiple species

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R