• Gene id: 6198

Gene Summary

• Gene Symbol: RPS6KB1   Gene   UCSC   Ensembl
• Aliases: PS6K, S6K, S6K-beta-1, S6K1, STK14A, p70 S6KA, p70(S6K)-alpha, p70-S6K, p70-alpha
• Gene name: ribosomal protein S6 kinase B1
• Alternate names: ribosomal protein S6 kinase beta-1, p70 S6 kinase, alpha, ribosomal protein S6 kinase I, ribosomal protein S6 kinase, 70kDa, polypeptide 1, serine/threonine kinase 14 alpha, serine/threonine-protein kinase 14A,
• Gene location: 17q23.1 (59893045: 59950573)     Exons: 19     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this ge
• OMIM: 608938

Protein Summary

• Protein general information: P23443  
  • Name: Ribosomal protein S6 kinase beta 1 (S6K beta 1) (S6K1) (EC 2.7.11.1) (70 kDa ribosomal protein S6 kinase 1) (P70S6K1) (p70 S6K 1) (Ribosomal protein S6 kinase I) (Serine/threonine protein kinase 14A) (p70 ribosomal S6 kinase alpha) (p70 S6 kinase alpha) (
  • Length: 525  
  • Mass: 59140
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPYELGMEHCEKFEIS
  ETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV
  KHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIM
  LNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
  TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQS
  EEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVK
  FSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

• Structural information:
  • Protein Domains: (91..35-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (353..42-)
    (/note="AGC-kinase-C-terminal")
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR016238  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • PDB: 3A60 3A61 3A62 3WE4 3WF5 3WF6 3WF7 3WF8 3WF9 4L3J 4L3L 4L42 4L43 4L44 4L45 4L46 4RLO 4RLP 5WBH 5WBK
  • PDBsum: 3A60 3A61 3A62 3WE4 3WF5 3WF6 3WF7 3WF8 3WF9 4L3J 4L3L 4L42 4L43 4L44 4L45 4L46 4RLO 4RLP 5WBH 5WBK
  • DIP: 29986
  • STRING: ENSP00000225577
• Other Databases: GeneCards:  RPS6KB1  Malacards:  RPS6KB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032869	cellular response to insulin stimulus	IBA	biological process
GO:0004711	ribosomal protein S6 kinase activity	IBA	molecular function
GO:0045948	positive regulation of translational initiation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0071363	cellular response to growth factor stimulus	IDA	biological process
GO:0031929	TOR signaling	IDA	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0031667	response to nutrient levels	IDA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IMP	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0000082	G1/S transition of mitotic cell cycle	IMP	biological process
GO:0018105	peptidyl-serine phosphorylation	IMP	biological process
GO:0044539	long-chain fatty acid import into cell	ISS	biological process
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IMP	biological process
GO:0045948	positive regulation of translational initiation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031929	TOR signaling	IMP	biological process
GO:0031929	TOR signaling	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045727	positive regulation of translation	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa05163	Human cytomegalovirus infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa04152	AMPK signaling pathway
hsa05231	Choline metabolism in cancer
hsa04931	Insulin resistance
hsa04666	Fc gamma R-mediated phagocytosis
hsa04066	HIF-1 signaling pathway
hsa04350	TGF-beta signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa01522	Endocrine resistance
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05221	Acute myeloid leukemia
hsa04213	Longevity regulating pathway - multiple species
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)