• Gene id: 6196

Gene Summary

• Gene Symbol: RPS6KA2   Gene   UCSC   Ensembl
• Aliases: HU-2, MAPKAPK1C, RSK, RSK3, S6K-alpha, S6K-alpha2, p90-RSK3, p90RSK2, pp90RSK3
• Gene name: ribosomal protein S6 kinase A2
• Alternate names: ribosomal protein S6 kinase alpha-2, MAP kinase-activated protein kinase 1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1C, mitogen-activated protein kinase-activated protein kinase 1C, ribosomal S6 kinase 3, ribosomal protein S6 kinase, 90kDa, polypeptide,
• Gene location: 6q27 (166862524: 166409363)     Exons: 26     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK)
• OMIM: 601685

Protein Summary

• Protein general information: Q15349  
  • Name: Ribosomal protein S6 kinase alpha 2 (S6K alpha 2) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 2) (p90 RSK 2) (p90RSK2) (MAP kinase activated protein kinase 1c) (MAPK activated protein kinase 1c) (MAPKAP kinase 1c) (MAPKAPK 1c) (Ribosomal S6 kinase 3
  • Length: 733  
  • Mass: 83239
  • Tissue specificity: Widely expressed with higher expression in lung, skeletal muscle, brain, uterus, ovary, thyroid and prostate. {ECO
• Sequence:

  MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFELLKVLGQGSYGKVFL
  VRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRL
  SKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEY
  MAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
  RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDSPGVPPSANAHHLFRG
  FSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKEDIGVGSYSVCKRCVHKATDTEYAVKIIDKSK
  RDPSEEIEILLRYGQHPNIITLKDVYDDGKFVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHS
  QGVVHRDLKPSNILYRDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
  LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNR
  EYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL

• Structural information:
  • Protein Domains: (59..31-)
    1 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (319..38-)
    (/note="AGC-kinase-C-terminal)
    (415..67-)
    2 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR016239  IPR042766  IPR041906  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • CDD: cd14178 cd05582
  • DIP: 295
  • STRING: ENSP00000427015
• Other Databases: GeneCards:  RPS6KA2  Malacards:  RPS6KA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004711	ribosomal protein S6 kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004711	ribosomal protein S6 kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa04150	mTOR signaling pathway
hsa04114	Oocyte meiosis
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa04931	Insulin resistance
hsa04914	Progesterone-mediated oocyte maturation
hsa04720	Long-term potentiation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray