• Gene id: 6195

Gene Summary

• Gene Symbol: RPS6KA1   Gene   UCSC   Ensembl
• Aliases: HU-1, MAPKAPK1, MAPKAPK1A, RSK, RSK1, p90Rsk
• Gene name: ribosomal protein S6 kinase A1
• Alternate names: ribosomal protein S6 kinase alpha-1, 90 kDa ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, MAPK-activated protein kinase 1a, MAPKAP kinase 1a, MAPKAPK-1a, RSK-1, S6K-alpha 1, dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1), p9,
• Gene location: 1p36.11 (26529760: 26575027)     Exons: 25     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) si
• OMIM: 601684

Protein Summary

• Protein general information: Q15418  
  • Name: Ribosomal protein S6 kinase alpha 1 (S6K alpha 1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90 RSK 1) (p90RSK1) (p90S6K) (MAP kinase activated protein kinase 1a) (MAPK activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK 1a) (Ribosomal S6
  • Length: 735  
  • Mass: 82723
• Sequence:

  MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGK
  VFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLF
  TRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGT
  VEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
  PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQL
  FRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVID
  KSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEY
  LHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
  GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWV
  TQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

• Structural information:
  • Protein Domains: (62..32-)
    1 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (322..39-)
    (/note="AGC-kinase-C-terminal)
    (418..67-)
    2 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR016239  IPR041906  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • CDD: cd05582
  • PDB: 2WNT 2Z7Q 2Z7R 2Z7S 3RNY 3TEI 4H3P 4NIF 5CSF 5CSI 5CSJ 5CSN 5N7D 5N7F 5N7G 5V61 5V62
  • PDBsum: 2WNT 2Z7Q 2Z7R 2Z7S 3RNY 3TEI 4H3P 4NIF 5CSF 5CSI 5CSJ 5CSN 5N7D 5N7F 5N7G 5V61 5V62
  • DIP: 29987
  • STRING: ENSP00000435412
• Other Databases: GeneCards:  RPS6KA1  Malacards:  RPS6KA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004711	ribosomal protein S6 kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:2000491	positive regulation of hepatic stellate cell activation	IMP	biological process
GO:0045597	positive regulation of cell differentiation	TAS	biological process
GO:0043555	regulation of translation in response to stress	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043620	regulation of DNA-templated transcription in response to stress	TAS	biological process
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0072574	hepatocyte proliferation	ISS	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	IDA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa04150	mTOR signaling pathway
hsa04114	Oocyte meiosis
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa04931	Insulin resistance
hsa04914	Progesterone-mediated oocyte maturation
hsa04720	Long-term potentiation
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R