• Gene id: 6192

Gene Summary

• Gene Symbol: RPS4Y1   Gene   UCSC   Ensembl
• Aliases: RPS4Y, S4
• Gene name: ribosomal protein S4 Y-linked 1
• Alternate names: 40S ribosomal protein S4, Y isoform 1, 40S ribosomal protein S4, Y, ribosomal protein S4, Y-linked, ribosomal protein S4Y, small ribosomal subunit protein eS4,
• Gene location: Yp11.2 (2841601: 2867267)     Exons: 7     NC_000024.10
• Gene summary(Entrez): Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosom
• OMIM: 470000

Protein Summary

• Protein general information: P22090  
  • Name: 40S ribosomal protein S4, Y isoform 1 (Small ribosomal subunit protein eS4)
  • Length: 263  
  • Mass: 29456
• Sequence:

  MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGK
  VRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYP
  DPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNI
  FVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG

• Structural information:
  • Protein Domains: (42..10-)
    (/note="S4-RNA-binding")
  • Interpro: IPR032277  IPR005824  IPR041982  IPR014722  IPR000876   IPR013845  IPR038237  IPR013843  IPR018199  IPR002942  
  • Prosite: PS00528 PS50889
  • CDD: cd06087 cd00165
  • PDB: 5AJ0 5FLX 6OLG 6OLZ
  • PDBsum: 5AJ0 5FLX 6OLG 6OLZ
• Other Databases: GeneCards:  RPS4Y1  Malacards:  RPS4Y1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0022627	cytosolic small ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0019843	rRNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0003735	structural constituent of ribosome	TAS	molecular function
GO:0022627	cytosolic small ribosomal subunit	TAS	cellular component
GO:0006412	translation	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005844	polysome	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0006412	translation	IMP	biological process
GO:0022627	cytosolic small ribosomal subunit	NAS	cellular component
GO:0003735	structural constituent of ribosome	IMP	molecular function
GO:0007275	multicellular organism development	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)