• Gene id: 6185

Gene Summary

• Gene Symbol: RPN2   Gene   UCSC   Ensembl
• Aliases: RIBIIR, RPN-II, RPNII, SWP1
• Gene name: ribophorin II
• Alternate names: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2, dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit, oligosaccharyltransferase complex subunit (non-catalytic), ribophorin-2,
• Gene location: 20q11.23 (37179045: 37241622)     Exons: 19     NC_000020.11
• Gene summary(Entrez): This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-S
• OMIM: 180490

Protein Summary

• Protein general information: P04844  
  • Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase subunit 2 (Dolichyl diphosphooligosaccharide protein glycosyltransferase 63 kDa subunit) (RIBIIR) (Ribophorin II) (RPN II) (Ribophorin 2)
  • Length: 631  
  • Mass: 69284
  • Tissue specificity: Expressed in all tissues tested.
• Sequence:

  MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYI
  RSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTA
  RLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
  PSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPL
  TQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIANTVELRVKISTEVGI
  TNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFV
  AEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQE
  IQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMF
  QTLKYLAILGSVTFLAGNRMLAQQAVKRTAH

• Structural information:
  • Interpro: IPR008814  
  • PDB: 6S7O 6S7T
  • PDBsum: 6S7O 6S7T
  • STRING: ENSP00000237530
• Other Databases: GeneCards:  RPN2  Malacards:  RPN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	NAS	contributes to
GO:0008250	oligosaccharyltransferase complex	TAS	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	NAS	biological process
GO:0008250	oligosaccharyltransferase complex	IBA	cellular component
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0008250	oligosaccharyltransferase complex	IEA	cellular component
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0043022	ribosome binding	IEA	molecular function
GO:0007568	aging	IEA	biological process
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0000421	autophagosome membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0006487	protein N-linked glycosylation	IDA	biological process
GO:0008250	oligosaccharyltransferase complex	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04141	Protein processing in endoplasmic reticulum
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881