• Gene id: 6183

Gene Summary

• Gene Symbol: MRPS12   Gene   UCSC   Ensembl
• Aliases: MPR-S12, MT-RPS12, RPMS12, RPS12, RPSM12
• Gene name: mitochondrial ribosomal protein S12
• Alternate names: 28S ribosomal protein S12, mitochondrial, MRP-S12, S12mt, mitochondrial small ribosomal subunit protein uS12m,
• Gene location: 19q13.2 (38930943: 38933167)     Exons: 4     NC_000019.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 603021

Protein Summary

• Protein general information: O15235  
  • Name: 28S ribosomal protein S12, mitochondrial (MRP S12) (S12mt) (MT RPS12) (Mitochondrial small ribosomal subunit protein uS12m)
  • Length: 138  
  • Mass: 15173
• Sequence:

  MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNS
  ANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK

• Structural information:
  • Interpro: IPR012340  IPR006032  IPR005679  
  • Prosite: PS00055
  • CDD: cd03368
  • PDB: 3J9M 6NU2 6NU3
  • PDBsum: 3J9M 6NU2 6NU3
  • STRING: ENSP00000384952
• Other Databases: GeneCards:  MRPS12  Malacards:  MRPS12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006412	translation	IBA	biological process
GO:0005840	ribosome	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005763	mitochondrial small ribosomal subunit	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0015935	small ribosomal subunit	IEA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003735	structural constituent of ribosome	TAS	molecular function
GO:0005761	mitochondrial ribosome	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003735	structural constituent of ribosome	ISS	molecular function
GO:0005763	mitochondrial small ribosomal subunit	ISS	cellular component
GO:0032543	mitochondrial translation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881