• Gene id: 6181

Gene Summary

• Gene Symbol: RPLP2   Gene   UCSC   Ensembl
• Aliases: D11S2243E, LP2, P2, RPP2
• Gene name: ribosomal protein lateral stalk subunit P2
• Alternate names: 60S acidic ribosomal protein P2, acidic ribosomal phosphoprotein P2, large ribosomal subunit protein P2, renal carcinoma antigen NY-REN-44, ribosomal protein, large, P2,
• Gene location: 11p15.5 (809966: 812875)     Exons: 5     NC_000011.10
• Gene summary(Entrez): Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pho
• OMIM: 180530

Protein Summary

• Protein general information: P05387  
  • Name: 60S acidic ribosomal protein P2 (Large ribosomal subunit protein P2) (Renal carcinoma antigen NY REN 44)
  • Length: 115  
  • Mass: 11665
• Sequence:

  MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSA
  APGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD

• Structural information:
  • Interpro: IPR038716  IPR027534  
  • PDB: 1S4J 2JDL 2LBF 2W1O 4BEH 4V6X 5DDZ 5GU4
  • PDBsum: 1S4J 2JDL 2LBF 2W1O 4BEH 4V6X 5DDZ 5GU4
  • STRING: ENSP00000322419
• Other Databases: GeneCards:  RPLP2  Malacards:  RPLP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005840	ribosome	IEA	cellular component
GO:0006414	translational elongation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006413	translational initiation	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003735	structural constituent of ribosome	IDA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IDA	cellular component
GO:0022625	cytosolic large ribosomal subunit	HDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881