• Gene id: 6176

Gene Summary

• Gene Symbol: RPLP1   Gene   UCSC   Ensembl
• Aliases: LP1, P1, RPP1
• Gene name: ribosomal protein lateral stalk subunit P1
• Alternate names: 60S acidic ribosomal protein P1, acidic ribosomal phosphoprotein P1, large ribosomal subunit protein P1, ribosomal protein, large, P1,
• Gene location: 15q23 (6852078: 6844794)     Exons: 8     NC_000012.12
• Gene summary(Entrez): Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pho
• OMIM: 180520

Protein Summary

• Protein general information: P05386  
  • Name: 60S acidic ribosomal protein P1 (Large ribosomal subunit protein P1)
  • Length: 114  
  • Mass: 11514
• Sequence:

  MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAA
  PAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD

• Structural information:
  • Interpro: IPR038716  IPR027534  
  • PDB: 2LBF 4BEH 4V6X
  • PDBsum: 2LBF 4BEH 4V6X
  • STRING: ENSP00000346037
• Other Databases: GeneCards:  RPLP1  Malacards:  RPLP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030295	protein kinase activator activity	IBA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0043021	ribonucleoprotein complex binding	IBA	molecular function
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006414	translational elongation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IDA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IDA	cellular component
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0022625	cytosolic large ribosomal subunit	HDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003735	structural constituent of ribosome	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881