• Gene id: 6175

Gene Summary

• Gene Symbol: RPLP0   Gene   UCSC   Ensembl
• Aliases: L10E, LP0, P0, PRLP0, RPP0
• Gene name: ribosomal protein lateral stalk subunit P0
• Alternate names: 60S acidic ribosomal protein P0, 60S ribosomal protein L10E, acidic ribosomal phosphoprotein P0, large ribosomal subunit protein uL10, neutral ribosomal phosphoprotein P0, ribosomal protein, large, P0,
• Gene location: 12q24.23 (22001135: 21957539)     Exons: 6     NC_000016.10
• Gene summary(Entrez): Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
• OMIM: 180510

Protein Summary

• Protein general information: P05388  
  • Name: 60S acidic ribosomal protein P0 (60S ribosomal protein L10E) (Large ribosomal subunit protein uL10)
  • Length: 317  
  • Mass: 34274
• Sequence:

  MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLENNPAL
  EKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRG
  TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASV
  CLQIGYPTVASVPHSIINGYKRVLALSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA
  KEESEESDEDMGFGLFD

• Structural information:
  • Interpro: IPR030670  IPR001790  IPR040637  
  • PDB: 4V6W 4V6X 5AJ0 6OLG
  • PDBsum: 4V6W 4V6X 5AJ0 6OLG
  • STRING: ENSP00000449328
• Other Databases: GeneCards:  RPLP0  Malacards:  RPLP0

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0070180	large ribosomal subunit rRNA binding	IBA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0002181	cytoplasmic translation	IBA	biological process
GO:0000027	ribosomal large subunit assembly	IBA	biological process
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005840	ribosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006413	translational initiation	TAS	biological process
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003735	structural constituent of ribosome	IDA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0022625	cytosolic large ribosomal subunit	HDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0098794	postsynapse	IDA	cellular component
GO:0098794	postsynapse	EXP	cellular component
GO:0014069	postsynaptic density	IDA	cellular component
GO:0014069	postsynaptic density	IDA	cellular component
GO:0014069	postsynaptic density	IDA	cellular component
GO:0014069	postsynaptic density	EXP	cellular component
GO:0014069	postsynaptic density	EXP	cellular component
GO:0014069	postsynaptic density	EXP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray