• Gene id: 6166

Gene Summary

• Gene Symbol: RPL36AL   Gene   UCSC   Ensembl
• Aliases: RPL36A
• Gene name: ribosomal protein L36a like
• Alternate names: 60S ribosomal protein L36a-like, large ribosomal subunit protein eL42-like, ribosomal protein HL44,
• Gene location: 14q21.3 (48552171: 48599426)     Exons: 7     NC_000019.10
• Gene summary(Entrez): Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribos
• OMIM: 180469

Protein Summary

• Protein general information: Q969Q0  
  • Name: 60S ribosomal protein L36a like (Large ribosomal subunit protein eL42 like)
  • Length: 106  
  • Mass: 12469
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQGRRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECVEP
  NCRSKRMLAIKRCKHFELGGDKKRKGQVIQF

• Structural information:
  • Interpro: IPR000552  IPR011332  
  • Prosite: PS01172
• Other Databases: GeneCards:  RPL36AL  Malacards:  RPL36AL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)