• Gene id: 6150

Gene Summary

• Gene Symbol: MRPL23   Gene   UCSC   Ensembl
• Aliases: L23MRP, RPL23, RPL23L
• Gene name: mitochondrial ribosomal protein L23
• Alternate names: 39S ribosomal protein L23, mitochondrial, L23 mitochondrial-related protein, L23mt, MRP-L23, mitochondrial large ribosomal subunit protein uL23m, ribosomal protein related to L23 (mitochondrial),
• Gene location: 11p15.5 (1947271: 2013175)     Exons: 11     NC_000011.10
• Gene summary(Entrez): Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• OMIM: 600789

Protein Summary

• Protein general information: Q16540  
  • Name: 39S ribosomal protein L23, mitochondrial (L23mt) (MRP L23) (L23 mitochondrial related protein) (Mitochondrial large ribosomal subunit protein uL23m) (Ribosomal protein L23 like)
  • Length: 153  
  • Mass: 17781
• Sequence:

  MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHG
  SNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSW
  FGL

• Structural information:
  • Interpro: IPR012677  IPR012678  IPR013025  
  • PDB: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • PDBsum: 3J7Y 3J9M 5OOL 5OOM 6NU2 6NU3
  • STRING: ENSP00000380466
• Other Databases: GeneCards:  MRPL23  Malacards:  MRPL23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032543	mitochondrial translation	IBA	biological process
GO:0005762	mitochondrial large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005762	mitochondrial large ribosomal subunit	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0003735	structural constituent of ribosome	TAS	molecular function
GO:0005762	mitochondrial large ribosomal subunit	TAS	cellular component
GO:0006412	translation	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0070125	mitochondrial translational elongation	TAS	biological process
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq