• Gene id: 6136

Gene Summary

• Gene Symbol: RPL12   Gene   UCSC   Ensembl
• Aliases: L12
• Gene name: ribosomal protein L12
• Alternate names: 60S ribosomal protein L12, large ribosomal subunit protein uL11,
• Gene location: 9q33.3 (127451405: 127447673)     Exons: 5     NC_000009.12
• Gene summary(Entrez): Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
• OMIM: 180475

Protein Summary

• Protein general information: P30050  
  • Name: 60S ribosomal protein L12 (Large ribosomal subunit protein uL11)
  • Length: 165  
  • Mass: 17819
• Sequence:

  MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVP
  SASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHD
  IIDDINSGAVECPAS

• Structural information:
  • Interpro: IPR000911  IPR036796  IPR020783  IPR036769  IPR020785   IPR020784  
  • Prosite: PS00359
  • CDD: cd00349
  • PDB: 4V6X 5A8L 5AJ0 6OLG
  • PDBsum: 4V6X 5A8L 5AJ0 6OLG
  • STRING: ENSP00000354739
• Other Databases: GeneCards:  RPL12  Malacards:  RPL12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070180	large ribosomal subunit rRNA binding	IBA	molecular function
GO:0022625	cytosolic large ribosomal subunit	IBA	cellular component
GO:0019843	rRNA binding	IBA	molecular function
GO:0006412	translation	IBA	biological process
GO:0005840	ribosome	IBA	cellular component
GO:0000027	ribosomal large subunit assembly	IBA	biological process
GO:0015934	large ribosomal subunit	IBA	cellular component
GO:0003735	structural constituent of ribosome	IBA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003735	structural constituent of ribosome	IEA	molecular function
GO:0005840	ribosome	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0022625	cytosolic large ribosomal subunit	HDA	cellular component
GO:0006412	translation	NAS	biological process
GO:0003735	structural constituent of ribosome	NAS	molecular function
GO:0014069	postsynaptic density	IDA	cellular component
GO:0014069	postsynaptic density	EXP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03010	Ribosome

Diseases

Associated diseases	References
Systemic lupus erythematosus	PMID:11161982
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)