• Gene id: 6120

Gene Summary

• Gene Symbol: RPE   Gene   UCSC   Ensembl
• Aliases: RPE2-1
• Gene name: ribulose-5-phosphate-3-epimerase
• Alternate names: ribulose-phosphate 3-epimerase,
• Gene location: 2q34 (210002564: 210023362)     Exons: 10     NC_000002.12
• OMIM: 180480

Protein Summary

• Protein general information: Q96AT9  
  • Name: Ribulose phosphate 3 epimerase (EC 5.1.3.1) (Ribulose 5 phosphate 3 epimerase)
  • Length: 228  
  • Mass: 24928
• Sequence:

  MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSK
  PEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQ
  KFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRS
  LDR

• Structural information:
  • Interpro: IPR013785  IPR026019  IPR000056  IPR011060  
  • Prosite: PS01085 PS01086
  • CDD: cd00429
  • PDB: 3OVP 3OVQ 3OVR 3QC3
  • PDBsum: 3OVP 3OVQ 3OVR 3QC3
  • STRING: ENSP00000352401
• Other Databases: GeneCards:  RPE  Malacards:  RPE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004750	ribulose-phosphate 3-epimerase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0009052	pentose-phosphate shunt, non-oxidative branch	IBA	biological process
GO:0019323	pentose catabolic process	IBA	biological process
GO:0046872	metal ion binding	IBA	molecular function
GO:0044262	cellular carbohydrate metabolic process	IBA	biological process
GO:0046872	metal ion binding	IDA	molecular function
GO:0006098	pentose-phosphate shunt	IDA	biological process
GO:0005975	carbohydrate metabolic process	IDA	biological process
GO:0004750	ribulose-phosphate 3-epimerase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0004750	ribulose-phosphate 3-epimerase activity	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0006098	pentose-phosphate shunt	IEA	biological process
GO:0016857	racemase and epimerase activity, acting on carbohydrates and derivatives	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0004750	ribulose-phosphate 3-epimerase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006098	pentose-phosphate shunt	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00040	Pentose and glucuronate interconversions
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq