Male Infertility Database

Search Result

Gene id

6119

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

RPA3 Gene UCSC Ensembl

Aliases

REPA3, RP-A p14

Gene name

replication protein A3

Alternate names

replication protein A 14 kDa subunit, RF-A protein 3, replication factor A protein 3, replication protein A3, 14kDa,

Gene location

7p21.3 (7718606: 7636517) Exons: 8 NC_000007.14

OMIM

179837

Protein Summary

Protein general information

P35244

Name: Replication protein A 14 kDa subunit (RP A p14) (Replication factor A protein 3) (RF A protein 3)

Length: 121 Mass: 13569

Sequence

MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTA
KATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD

Structural information

Interpro:	IPR012340 IPR013970
PDB:	1L1O 1QUQ 2PI2 2PQA 2Z6K 3KDF
PDBsum:	1L1O 1QUQ 2PI2 2PQA 2Z6K 3KDF
DIP:	24190
MINT:
STRING:	ENSP00000223129

Other Databases

GeneCards: RPA3 Malacards: RPA3

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0006260	DNA replication	IBA	biological process
GO:0006284	base-excision repair	IBA	biological process
GO:0006289	nucleotide-excision repai r	IBA	biological process
GO:0006298	mismatch repair	IBA	biological process
GO:0000724	double-strand break repai r via homologous recombin ation	IBA	biological process
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0003697	single-stranded DNA bindi ng	IBA	molecular function
GO:0005662	DNA replication factor A complex	IBA	cellular component
GO:0035861	site of double-strand bre ak	IBA	cellular component
GO:0006284	base-excision repair	IDA	biological process
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0003697	single-stranded DNA bindi ng	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0006298	mismatch repair	IMP	biological process
GO:0006289	nucleotide-excision repai r	IMP	biological process
GO:0006260	DNA replication	IMP	biological process
GO:0000724	double-strand break repai r via homologous recombin ation	IMP	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological process
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological process
GO:0042276	error-prone translesion s ynthesis	TAS	biological process
GO:0042276	error-prone translesion s ynthesis	TAS	biological process
GO:0042276	error-prone translesion s ynthesis	TAS	biological process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological process
GO:0000082	G1/S transition of mitoti c cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006293	nucleotide-excision repai r, preincision complex st abilization	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006295	nucleotide-excision repai r, DNA incision, 3'-to le sion	TAS	biological process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological process
GO:0006297	nucleotide-excision repai r, DNA gap filling	TAS	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replica tion	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replica tion	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replica tion	TAS	biological process
GO:0036297	interstrand cross-link re pair	TAS	biological process
GO:0042769	DNA damage response, dete ction of DNA damage	TAS	biological process
GO:0070987	error-free translesion sy nthesis	TAS	biological process
GO:1900034	regulation of cellular re sponse to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042127	regulation of cell popula tion proliferation	IEA	biological process
GO:0007346	regulation of mitotic cel l cycle	IEA	biological process
GO:0000723	telomere maintenance	TAS	biological process
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa03460	Fanconi anemia pathway
hsa03420	Nucleotide excision repair
hsa03440	Homologous recombination
hsa03030	DNA replication
hsa03430	Mismatch repair

Diseases

Expand All | Collapse All

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia			19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All