• Gene id: 6118

Gene Summary

• Gene Symbol: RPA2   Gene   UCSC   Ensembl
• Aliases: REPA2, RP-A p32, RP-A p34, RPA32
• Gene name: replication protein A2
• Alternate names: replication protein A 32 kDa subunit, RF-A protein 2, replication factor A protein 2, replication protein A 34 kDa subunit,
• Gene location: 1p35.3 (27914796: 27891523)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication, repair, r
• OMIM: 179836

Protein Summary

• Protein general information: P15927  
  • Name: Replication protein A 32 kDa subunit (RP A p32) (Replication factor A protein 2) (RF A protein 2) (Replication protein A 34 kDa subunit) (RP A p34)
  • Length: 270  
  • Mass: 29247
• Sequence:

  MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVT
  IVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLE
  DMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGL
  NFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE

• Structural information:
  • Interpro: IPR012340  IPR040260  IPR014646  IPR014892  IPR036388   IPR036390  
  • PDB: 1DPU 1L1O 1QUQ 1Z1D 2PI2 2PQA 2Z6K 3KDF 4MQV 4OU0
  • PDBsum: 1DPU 1L1O 1QUQ 1Z1D 2PI2 2PQA 2Z6K 3KDF 4MQV 4OU0
  • DIP: 24187
  • STRING: ENSP00000363017
• Other Databases: GeneCards:  RPA2  Malacards:  RPA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IDA	cellular component
GO:0005662	DNA replication factor A complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0006260	DNA replication	IBA	biological process
GO:0006284	base-excision repair	IDA	biological process
GO:0006260	DNA replication	IDA	biological process
GO:0000781	chromosome, telomeric region	IDA	colocalizes with
GO:0035861	site of double-strand break	IDA	colocalizes with
GO:0016605	PML body	IDA	colocalizes with
GO:0016605	PML body	IDA	cellular component
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IC	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0034502	protein localization to chromosome	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0034502	protein localization to chromosome	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031571	mitotic G1 DNA damage checkpoint	IMP	biological process
GO:0006298	mismatch repair	IMP	biological process
GO:0006289	nucleotide-excision repair	IMP	biological process
GO:0006260	DNA replication	IMP	biological process
GO:0000723	telomere maintenance	IMP	biological process
GO:2000001	regulation of DNA damage checkpoint	IMP	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005662	DNA replication factor A complex	IPI	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0036297	interstrand cross-link repair	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005662	DNA replication factor A complex	IEA	cellular component
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0098505	G-rich strand telomeric DNA binding	IDA	molecular function
GO:0000723	telomere maintenance	IC	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0010569	regulation of double-strand break repair via homologous recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03460	Fanconi anemia pathway
hsa03420	Nucleotide excision repair
hsa03440	Homologous recombination
hsa03030	DNA replication
hsa03430	Mismatch repair

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881