• Gene id: 6117

Gene Summary

• Gene Symbol: RPA1   Gene   UCSC   Ensembl
• Aliases: HSSB, MST075, REPA1, RF-A, RP-A, RPA70
• Gene name: replication protein A1
• Alternate names: replication protein A 70 kDa DNA-binding subunit, MSTP075, RF-A protein 1, RP-A p70, replication factor A protein 1, replication protein A1, 70kDa, single-stranded DNA-binding protein,
• Gene location: 17p13.3 (3880726: 3725053)     Exons: 33     NC_000016.10
• Gene summary(Entrez): This gene encodes the largest subunit of the heterotrimeric Replication Protein A (RPA) complex, which binds to single-stranded DNA (ssDNA), forming a nucleoprotein complex that plays an important role in DNA metabolism, being involved in DNA replication,
• OMIM: 179835

Protein Summary

• Protein general information: P27694  
  • Name: Replication protein A 70 kDa DNA binding subunit (RP A p70) (Replication factor A protein 1) (RF A protein 1) (Single stranded DNA binding protein) [Cleaved into: Replication protein A 70 kDa DNA binding subunit, N terminally processed]
  • Length: 616  
  • Mass: 68138
• Sequence:

  MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNC
  VCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNEGLGQPQVAPPAPAASPAASSRPQPQNGSSG
  MGSTVSKAYGASKTFGKAAGPSLSHTSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLE
  LVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQF
  DFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPV
  LAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKS
  ENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQE
  NQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYR
  EYGRRLVMSIRRSALM

• Structural information:
  • Interpro: IPR012340  IPR004365  IPR013955  IPR007199  IPR031657   IPR004591  
  • CDD: cd04476 cd04477
  • PDB: 1EWI 1FGU 1JMC 1L1O 2B29 2B3G 4IJH 4IJL 4IPC 4IPD 4IPG 4IPH 4LUO 4LUV 4LUZ 4LW1 4LWC 4NB3 4O0A 4R4C 4R4I 4R4O 4R4Q 4R4T 5E7N 5EAY 5N85 5N8A
  • PDBsum: 1EWI 1FGU 1JMC 1L1O 2B29 2B3G 4IJH 4IJL 4IPC 4IPD 4IPG 4IPH 4LUO 4LUV 4LUZ 4LW1 4LWC 4NB3 4O0A 4R4C 4R4I 4R4O 4R4Q 4R4T 5E7N 5EAY 5N85 5N8A
  • DIP: 24189
  • STRING: ENSP00000254719
• Other Databases: GeneCards:  RPA1  Malacards:  RPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006281	DNA repair	IMP	biological process
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0007004	telomere maintenance via telomerase	IBA	biological process
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0000723	telomere maintenance	IBA	biological process
GO:0043047	single-stranded telomeric DNA binding	IBA	molecular function
GO:0006261	DNA-dependent DNA replication	IBA	biological process
GO:0005662	DNA replication factor A complex	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0003684	damaged DNA binding	IBA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IBA	cellular component
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0006284	base-excision repair	IDA	biological process
GO:0016605	PML body	IDA	colocalizes with
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003697	single-stranded DNA binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0034502	protein localization to chromosome	IDA	biological process
GO:0034502	protein localization to chromosome	IDA	biological process
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0003684	damaged DNA binding	IDA	molecular function
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0005662	DNA replication factor A complex	IDA	cellular component
GO:0006298	mismatch repair	IMP	biological process
GO:0006289	nucleotide-excision repair	IMP	biological process
GO:0006260	DNA replication	IMP	biological process
GO:0000723	telomere maintenance	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000724	double-strand break repair via homologous recombination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0006310	DNA recombination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006261	DNA-dependent DNA replication	TAS	biological process
GO:0006310	DNA recombination	TAS	biological process
GO:0016605	PML body	IDA	cellular component
GO:0005662	DNA replication factor A complex	IPI	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0033683	nucleotide-excision repair, DNA incision	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:0042276	error-prone translesion synthesis	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006293	nucleotide-excision repair, preincision complex stabilization	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006295	nucleotide-excision repair, DNA incision, 3'-to lesion	TAS	biological process
GO:0006296	nucleotide-excision repair, DNA incision, 5'-to lesion	TAS	biological process
GO:0006297	nucleotide-excision repair, DNA gap filling	TAS	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0036297	interstrand cross-link repair	TAS	biological process
GO:0042769	DNA damage response, detection of DNA damage	TAS	biological process
GO:0070987	error-free translesion synthesis	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005662	DNA replication factor A complex	IEA	cellular component
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0098505	G-rich strand telomeric DNA binding	IDA	molecular function
GO:0098505	G-rich strand telomeric DNA binding	IDA	molecular function
GO:0098505	G-rich strand telomeric DNA binding	IMP	molecular function
GO:0000723	telomere maintenance	IC	biological process
GO:0000723	telomere maintenance	IC	biological process
GO:0000723	telomere maintenance	IC	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090734	site of DNA damage	IMP	cellular component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03460	Fanconi anemia pathway
hsa03420	Nucleotide excision repair
hsa03440	Homologous recombination
hsa03030	DNA replication
hsa03430	Mismatch repair

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq