• Gene id: 6093

Gene Summary

• Gene Symbol: ROCK1   Gene   UCSC   Ensembl
• Aliases: P160ROCK, ROCK-I
• Gene name: Rho associated coiled-coil containing protein kinase 1
• Alternate names: rho-associated protein kinase 1, p160 ROCK-1, renal carcinoma antigen NY-REN-35,
• Gene location: 18q11.1 (21111812: 20946905)     Exons: 33     NC_000018.10
• Gene summary(Entrez): This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets a
• OMIM: 601702

Protein Summary

• Protein general information: Q13464  
  • Name: Rho associated protein kinase 1 (EC 2.7.11.1) (Renal carcinoma antigen NY REN 35) (Rho associated, coiled coil containing protein kinase 1) (Rho associated, coiled coil containing protein kinase I) (ROCK I) (p160 ROCK 1) (p160ROCK)
  • Length: 1354  
  • Mass: 158175
  • Tissue specificity: Detected in blood platelets. {ECO
• Sequence:

  MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAED
  YEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLY
  MVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNK
  EGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
  DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDK
  GEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEME
  QKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLED
  LKKVSQNSQLANEKLSQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
  KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLNHSEKEKNNLEIDLNY
  KLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVQIEKQCSMLDVDLKQ
  SQQKLEHLTGNKERMEDEVKNLTLQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFEL
  AQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
  SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKL
  EKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQ
  MVVKHQKELNDMQAQLVEECAHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWL
  SVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
  ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALECRRCHVKCHRDHLDK
  KEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKVVKNTS
  GKTS

• Structural information:
  • Protein Domains: (76..33-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (341..40-)
    (/note="AGC-kinase-C-terminal)
    (479..55-)
    (/note="REM-1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01207-)
    (949..101-)
    (/note="RhoB-)
  • Interpro: IPR000961  IPR011009  IPR002219  IPR011993  IPR001849   IPR000719  IPR017441  IPR015008  IPR020684  IPR037310  IPR008271  
  • Prosite: PS51285 PS50003 PS00107 PS50011 PS00108 PS51860 PS51859 PS50081
  • CDD: cd00029 cd11639
  • PDB: 1S1C 2ESM 2ETK 2ETR 2V55 3D9V 3NCZ 3NDM 3O0Z 3TV7 3TWJ 3V8S 4L2W 4W7P 4YVC 4YVE 5BML 5F5P 5HVU 5KKS 5KKT 5UZJ 5WNE 5WNF 5WNG 5WNH 6E9W
  • PDBsum: 1S1C 2ESM 2ETK 2ETR 2V55 3D9V 3NCZ 3NDM 3O0Z 3TV7 3TWJ 3V8S 4L2W 4W7P 4YVC 4YVE 5BML 5F5P 5HVU 5KKS 5KKT 5UZJ 5WNE 5WNF 5WNG 5WNH 6E9W
  • DIP: 35645
  • STRING: ENSP00000382697
• Other Databases: GeneCards:  ROCK1  Malacards:  ROCK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0106003	amyloid-beta complex	IDA	colocalizes with
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0140058	neuron projection arborization	IGI	biological process
GO:0007266	Rho protein signal transduction	IGI	biological process
GO:0019828	aspartic-type endopeptidase inhibitor activity	IMP	molecular function
GO:0110061	regulation of angiotensin-activated signaling pathway	IMP	biological process
GO:0097746	regulation of blood vessel diameter	ISS	biological process
GO:1990776	response to angiotensin	ISS	biological process
GO:1905205	positive regulation of connective tissue replacement	IMP	biological process
GO:1902992	negative regulation of amyloid precursor protein catabolic process	IMP	biological process
GO:1902992	negative regulation of amyloid precursor protein catabolic process	IMP	biological process
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:1900223	positive regulation of amyloid-beta clearance	IGI	biological process
GO:1900242	regulation of synaptic vesicle endocytosis	IGI	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0010628	positive regulation of gene expression	ISS	biological process
GO:0010506	regulation of autophagy	TAS	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	TAS	biological process
GO:1902003	regulation of amyloid-beta formation	TAS	biological process
GO:1902430	negative regulation of amyloid-beta formation	IMP	biological process
GO:1902430	negative regulation of amyloid-beta formation	IMP	biological process
GO:0010508	positive regulation of autophagy	IGI	biological process
GO:0071559	response to transforming growth factor beta	ISS	biological process
GO:0031175	neuron projection development	IGI	biological process
GO:0045664	regulation of neuron differentiation	IGI	biological process
GO:0061157	mRNA destabilization	ISS	biological process
GO:0000281	mitotic cytokinesis	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0017049	GTP-Rho binding	IBA	molecular function
GO:0018107	peptidyl-threonine phosphorylation	IBA	biological process
GO:0007266	Rho protein signal transduction	IBA	biological process
GO:0010494	cytoplasmic stress granule	IBA	cellular component
GO:0030866	cortical actin cytoskeleton organization	IBA	biological process
GO:0031032	actomyosin structure organization	IBA	biological process
GO:0048598	embryonic morphogenesis	IBA	biological process
GO:0072518	Rho-dependent protein serine/threonine kinase activity	IBA	molecular function
GO:1901888	regulation of cell junction assembly	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0030334	regulation of cell migration	IDA	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:2000145	regulation of cell motility	TAS	biological process
GO:2000114	regulation of establishment of cell polarity	TAS	biological process
GO:0051492	regulation of stress fiber assembly	TAS	biological process
GO:0045616	regulation of keratinocyte differentiation	IMP	biological process
GO:0030155	regulation of cell adhesion	TAS	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0006939	smooth muscle contraction	TAS	biological process
GO:0001726	ruffle	ISS	cellular component
GO:0051894	positive regulation of focal adhesion assembly	ISS	biological process
GO:0051893	regulation of focal adhesion assembly	TAS	biological process
GO:0051451	myoblast migration	ISS	biological process
GO:0032956	regulation of actin cytoskeleton organization	TAS	biological process
GO:0030027	lamellipodium	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0017048	Rho GTPase binding	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0017049	GTP-Rho binding	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007266	Rho protein signal transduction	TAS	biological process
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990776	response to angiotensin	IEA	biological process
GO:0061157	mRNA destabilization	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0051451	myoblast migration	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0032970	regulation of actin filament-based process	IEA	biological process
GO:0032060	bleb assembly	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0097746	regulation of blood vessel diameter	IEA	biological process
GO:0071559	response to transforming growth factor beta	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0003383	apical constriction	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0022614	membrane to membrane docking	IDA	biological process
GO:0050900	leukocyte migration	IDA	biological process
GO:0050901	leukocyte tethering or rolling	IDA	biological process
GO:0003180	aortic valve morphogenesis	ISS	biological process
GO:0070168	negative regulation of biomineral tissue development	ISS	biological process
GO:0032059	bleb	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0072518	Rho-dependent protein serine/threonine kinase activity	IDA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:1903140	regulation of establishment of endothelial barrier	IGI	biological process
GO:1903140	regulation of establishment of endothelial barrier	IMP	biological process
GO:0035509	negative regulation of myosin-light-chain-phosphatase activity	IGI	biological process
GO:0072659	protein localization to plasma membrane	IGI	biological process
GO:0030866	cortical actin cytoskeleton organization	IGI	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0030866	cortical actin cytoskeleton organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903347	negative regulation of bicellular tight junction assembly	IGI	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0035509	negative regulation of myosin-light-chain-phosphatase activity	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05130	Pathogenic Escherichia coli infection
hsa04360	Axon guidance
hsa05205	Proteoglycans in cancer
hsa04022	cGMP-PKG signaling pathway
hsa04530	Tight junction
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04071	Sphingolipid signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04350	TGF-beta signaling pathway
P06959	CCKR signaling map

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R