• Gene id: 60681

Gene Summary

• Gene Symbol: FKBP10   Gene   UCSC   Ensembl
• Aliases: BRKS1, FKBP65, OI11, OI6, PPIASE, hFKBP65
• Gene name: FKBP prolyl isomerase 10
• Alternate names: peptidyl-prolyl cis-trans isomerase FKBP10, 65 kDa FK506-binding protein, 65 kDa FKBP, FK506 binding protein 10, 65 kDa, FK506-binding protein 10, FKBP-10, FKBP-65, PPIase FKBP10, immunophilin FKBP65, rotamase,
• Gene location: 17q21.2 (41812937: 41823214)     Exons: 11     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoform
• OMIM: 607063

Protein Summary

• Protein general information: Q96AY3  
  • Name: Peptidyl prolyl cis trans isomerase FKBP10 (PPIase FKBP10) (EC 5.2.1.8) (65 kDa FK506 binding protein) (65 kDa FKBP) (FKBP 65) (FK506 binding protein 10) (FKBP 10) (Immunophilin FKBP65) (Rotamase)
  • Length: 582  
  • Mass: 64245
• Sequence:

  MFPAGPPSHSLLRLPLLQLLLLVVQAVGRGLGRASPAGGPLEDVVIERYHIPRACPREVQMGDFVRYHYNGTFED
  GKKFDSSYDRNTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVW
  NKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGTLLDGTSFDTSYSKGGTYDTYVGSGWLIKGMDQGLLGMCPGE
  RRKIIIPPFLAYGEKGYGTVIPPQASLVFHVLLIDVHNPKDAVQLETLELPPGCVRRAGAGDFMRYHYNGSLMDG
  TLFDSSYSRNHTYNTYIGQGYIIPGMDQGLQGACMGERRRITIPPHLAYGENGTGDKIPGSAVLIFNVHVIDFHN
  PADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGE
  RRQLIVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPTGYLFVWHKDPPANLFEDMDLNKDGEVPPEEFSTF
  IKAQVSEGKGRLMPGQDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL

• Structural information:
  • Protein Domains: (62..15-)
    1 (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277-)
    (174..26-)
    2 (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277-)
    (286..37-)
    3 (/note="PPIase-FKBP-type)
    (/evidence="ECO:-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR023566  IPR001179  
  • Prosite: PS00018 PS50222 PS00014 PS50059
  • CDD: cd00051
  • STRING: ENSP00000317232
• Other Databases: GeneCards:  FKBP10  Malacards:  FKBP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0018208	peptidyl-proline modification	IEA	biological process
GO:0005528	FK506 binding	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process

Diseases

Associated diseases	References
Osteogenesis imperfecta	KEGG:H00506
Bruck syndrome	KEGG:H00514
Osteogenesis imperfecta	KEGG:H00506
Bruck syndrome	KEGG:H00514
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881