• Gene id: 60675

Gene Summary

• Gene Symbol: PROK2   Gene   UCSC   Ensembl
• Aliases: BV8, HH4, KAL4, MIT1, PK2
• Gene name: prokineticin 2
• Alternate names: prokineticin-2, protein Bv8 homolog,
• Gene location: 3p13 (71785205: 71771654)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precurso
• OMIM: 607002

Protein Summary

• Protein general information: Q9HC23  
  • Name: Prokineticin 2 (PK2) (Protein Bv8 homolog)
  • Length: 129  
  • Mass: 14,314
• Sequence:

  MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKN
  NFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK

• Structural information:
  • Interpro: IPR009523  IPR023569  
  • STRING: ENSP00000295619
• Other Databases: GeneCards:  PROK2  Malacards:  PROK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001664	G-protein coupled receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005623	cell	IEA	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IMP	biological process
GO:0007623	circadian rhythm	IBA	biological process
GO:0008283	cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0019233	sensory perception of pain	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IDA	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001664	G-protein coupled receptor binding	IEA	molecular function
GO:0001664	G-protein coupled receptor binding	TAS	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005623	cell	IEA	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007283	spermatogenesis	IMP	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0007623	circadian rhythm	IBA	biological process
GO:0008283	cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0019233	sensory perception of pain	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IDA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0001664	G-protein coupled receptor binding	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	TAS	biological process
GO:0007283	spermatogenesis	IMP	biological process
GO:0007623	circadian rhythm	IBA	biological process
GO:0008283	cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IBA	biological process
GO:0019233	sensory perception of pain	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0045987	positive regulation of smooth muscle contraction	IDA	biological process

Diseases

Associated diseases	References
Obesity	GAD: 20734064
Kallmann syndrome (KS)	GAD: 18723471
Congenital hypogonadotropic hypogonadism (CHH)	MIK: 25531638
Azoospermia	MIK: 19478329
Oligozoospermia	MIK: 19478329
Congenital hypogonadotropic hypogonadism	MIK: 25531638
Cryptorchidism	MIK: 27561106
Male infertility	MIK: 27561106
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25531638	Congenital hypogonadotropic hypogonadism	p.R117W mutation in PROK2, p.E90K mutation in GNRHR		2 patients, controls	Male infertility	GNRHR PROKR2 FGFR1
27561106	Cryptorchidism, Male infertility			15 (7 high fertility risk, 8 low fertility risk )	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
19478329	Azoospermia, Oligozoospermia	rs4484160	Caucasi an	43 cases	Male infertility	GWAS