• Gene id: 60673

Gene Summary

• Gene Symbol: ATG101   Gene   UCSC   Ensembl
• Aliases: C12orf44
• Gene name: autophagy related 101
• Alternate names: autophagy-related protein 101, Atg13-interacting protein,
• Gene location: 12q13.13 (52069922: 52077494)     Exons: 5     NC_000012.12
• OMIM: 606803

Protein Summary

• Protein general information: Q9BSB4  
  • Name: Autophagy related protein 101
  • Length: 218  
  • Mass: 25003
• Sequence:

  MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRA
  LRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCE
  KIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL

• Structural information:
  • Interpro: IPR012445  
  • PDB: 4WZG 5C50 5XUY 5XV1 5XV3 5XV4 5XV6
  • PDBsum: 4WZG 5C50 5XUY 5XV1 5XV3 5XV4 5XV6
  • DIP: 60653
  • STRING: ENSP00000338990
• Other Databases: GeneCards:  ATG101  Malacards:  ATG101

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000045	autophagosome assembly	IBA	biological process
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0000407	phagophore assembly site	IDA	cellular component
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000407	phagophore assembly site	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04211	Longevity regulating pathway
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881