• Gene id: 60598

Gene Summary

• Gene Symbol: KCNK15   Gene   UCSC   Ensembl
• Aliases: K2p15.1, KCNK11, KCNK14, KT3.3, TASK-5, TASK5, dJ781B1.1
• Gene name: potassium two pore domain channel subfamily K member 15
• Alternate names: potassium channel subfamily K member 15, TWIK-related acid-sensitive K(+) channel 5, TWIK-related acid-sensitive K+ 5, acid-sensitive potassium channel protein TASK-5, potassium channel, subfamily K, member 14, potassium channel, two pore domain subfamily K, m,
• Gene location: 20q13.12 (44745604: 44752312)     Exons: 3     NC_000020.11
• Gene summary(Entrez): This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins fo
• OMIM: 612159

Protein Summary

• Protein general information: Q9H427  
  • Name: Potassium channel subfamily K member 15 (Acid sensitive potassium channel protein TASK 5) (TWIK related acid sensitive K(+) channel 5) (Two pore potassium channel KT3.3) (Two pore K(+) channel KT3.3)
  • Length: 330  
  • Mass: 36130
  • Tissue specificity: Detected in pancreas, heart, placenta, lung, liver, kidney, ovary, testis, skeletal muscle and adrenal gland, and at lower levels in prostate, spleen and thyroid gland. {ECO
• Sequence:

  MRRPSVRAAGLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRRKFGFSAEDYRELERLALQAEPHRAG
  RQWKFPGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNAVVRRLLLAAKCCLGLR
  WTCVSTENLVVAGLLACAATLALGAVAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQSGEALQRKLPYVAFSF
  LYILLGLTVIGAFLNLVVLRFLVASADWPERAARPPSPRPPGAPESRGLWLPRRPARSVGSASVFCHVHKLERCA
  RDNLGFSPPSSPGVVRGGQAPRPGARWKSI

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR013099  IPR008073  
  • STRING: ENSP00000361952
• Other Databases: GeneCards:  KCNK15  Malacards:  KCNK15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005244	voltage-gated ion channel activity	IDA	NOT|molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray