• Gene id: 60592

Gene Summary

• Gene Symbol: SCOC   Gene   UCSC   Ensembl
• Aliases: HRIHFB2072, SCOCO, UNC-69
• Gene name: short coiled-coil protein
• Alternate names: short coiled-coil protein,
• Gene location: 4q31.1 (140257307: 140385727)     Exons: 7     NC_000004.12
• Gene summary(Entrez): This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative spli

Protein Summary

• Protein general information: Q9UIL1  
  • Name: Short coiled coil protein
  • Length: 159  
  • Mass: 18045
  • Tissue specificity: Widely expressed with highest levels in brain, heart and skeletal muscle. {ECO
• Sequence:

  MRRRVFSSQDWRASGWDGMGFFSRRTFCGRSGRSCRGQLVQVSRPEVSAGSLLLPAPQAEDHSSRILYPRPKSLL
  PKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQ
  TTDTKSKRK

• Structural information:
  • Interpro: IPR019357  
  • PDB: 4BWD
  • PDBsum: 4BWD
  • STRING: ENSP00000477352
• Other Databases: GeneCards:  SCOC  Malacards:  SCOC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IDA	colocalizes with
GO:0005802	trans-Golgi network	IDA	colocalizes with
GO:0016239	positive regulation of macroautophagy	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0061635	regulation of protein complex stability	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq