• Gene id: 60559

Gene Summary

• Gene Symbol: SPCS3   Gene   UCSC   Ensembl
• Aliases: PRO3567, SPC22, SPC22/23, SPC23, SPC3, YLR066W
• Gene name: signal peptidase complex subunit 3
• Alternate names: signal peptidase complex subunit 3, SPase 22 kDa subunit, SPase 22/23 kDa subunit, microsomal signal peptidase 22/23 kDa subunit, microsomal signal peptidase 23 kDa subunit, signal peptidase complex subunit 3 homolog,
• Gene location: 4q34.2 (176319965: 176332244)     Exons: 5     NC_000004.12
• OMIM: 618854

Protein Summary

• Protein general information: P61009  
  • Name: Signal peptidase complex subunit 3 (EC 3.4. . ) (Microsomal signal peptidase 22/23 kDa subunit) (SPC22/23) (SPase 22/23 kDa subunit)
  • Length: 180  
  • Mass: 20313
• Sequence:

  MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSRIMLKNVEDFTGPRERSDLGFITFDITADLE
  NIFDWNVKQLFLYLSAEYSTKNNALNQVVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNRNVTLTLSWNV
  VPNAGILPLVTGSGHVSVPFPDTYEITKSY

• Structural information:
  • Interpro: IPR007653  
  • STRING: ENSP00000427463
• Other Databases: GeneCards:  SPCS3  Malacards:  SPCS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IBA	molecular function
GO:0006465	signal peptide processing	IBA	biological process
GO:0005787	signal peptidase complex	IBA	cellular component
GO:0045047	protein targeting to ER	IBA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0005787	signal peptidase complex	IEA	cellular component
GO:0006465	signal peptide processing	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0019082	viral protein processing	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray