• Gene id: 60509

Gene Summary

• Gene Symbol: AGBL5   Gene   UCSC   Ensembl
• Aliases: CCP5, RP75
• Gene name: ATP/GTP binding protein like 5
• Alternate names: cytosolic carboxypeptidase-like protein 5, cytosolic carboxypeptidase 5,
• Gene location: 2p23.3 (27051422: 27070621)     Exons: 8     NC_000002.12
• Gene summary(Entrez): This gene encodes a metallocarboxypeptidase involved in protein deglutamylation and a member of the peptidase M14 family of proteins. The encoded protein has been described as a "dual-functional" deglutamylase that can remove glutamate residues from both
• OMIM: 615900

Protein Summary

• Protein general information: Q8NDL9  
  • Name: Cytosolic carboxypeptidase like protein 5 (EC 3.4.17. ) (ATP/GTP binding protein like 5)
  • Length: 886  
  • Mass: 97534
  • Tissue specificity: Expressed in brain.
• Sequence:

  MELRCGGLLFSSRFDSGNLAHVEKVESLSSDGEGVGGGASALTSGIASSPDYEFNVWTRPDCAETEFENGNRSWF
  YFSVRGGMPGKLIKINIMNMNKQSKLYSQGMAPFVRTLPTRPRWERIRDRPTFEMTETQFVLSFVHRFVEGRGAT
  TFFAFCYPFSYSDCQELLNQLDQRFPENHPTHSSPLDTIYYHRELLCYSLDGLRVDLLTITSCHGLREDREPRLE
  QLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRG
  HYRTDSRGVNLNRQYLKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEHQPSSCLPPDAPVSDLEKANNLQNEA
  QCGHSADRHNAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDTIPPKESGVAYYVDLHGHASKRGCFMYGNSFS
  DESTQVENMLYPKLISLNSAHFDFQGCNFSEKNMYARDRRDGQSKEGSGRVAIYKASGIIHSYTLECNYNTGRSV
  NSIPAACHDNGRASPPPPPAFPSRYTVELFEQVGRAMAIAALDMAECNPWPRIVLSEHSSLTNLRAWMLKHVRNS
  RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGGSSSSQQNSPQMKNSPSFPFHGSRPA
  GLPGLGSSTQKVTHRVLGPVREPRSQDRRRQQQPLNHRPAGSLAPSPAPTSSGPASSHKLGSCLLPDSFNIPGSS
  CSLLSSGDKPEAVMVIGKGLLGTGARMPCIKTRLQARPRLGRGSPPTRRGMKGSSGPTSPTPRTRESSELELGSC
  SATPGLPQARPPRPRSAPAFSPISCSLSDSPSWNCYSRGPLGQPEVCFVPKSPPLTVSPRV

• Structural information:
  • Interpro: IPR040626  IPR000834  
  • STRING: ENSP00000353249
• Other Databases: GeneCards:  AGBL5  Malacards:  AGBL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035608	protein deglutamylation	IBA	biological process
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0035611	protein branching point deglutamylation	ISS	biological process
GO:0015631	tubulin binding	ISS	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0004181	metallocarboxypeptidase activity	ISS	molecular function
GO:0051607	defense response to virus	ISS	biological process
GO:0035608	protein deglutamylation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0035608	protein deglutamylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0051607	defense response to virus	IEA	biological process
GO:0035611	protein branching point deglutamylation	IEA	biological process
GO:0015631	tubulin binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Retinitis pigmentosa	KEGG:H00527
Retinitis pigmentosa	KEGG:H00527
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 30635446
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
30635446	Male infertility				Male infertility