• Gene id: 60495

Gene Summary

• Gene Symbol: HPSE2   Gene   UCSC   Ensembl
• Aliases: HPA2, HPR2, UFS, UFS1
• Gene name: heparanase 2 (inactive)
• Alternate names: inactive heparanase-2, heparanase 3, heparanase-like protein,
• Gene location: 10q24.2 (128818401: 128822675)     Exons: 4     NC_000009.12
• Gene summary(Entrez): This gene encodes a heparanase enzyme. The encoded protein is a endoglycosidase that degrades heparin sulfate proteoglycans located on the extracellular matrix and cell surface. This protein may be involved in biological processes involving remodeling of
• OMIM: 613469

Protein Summary

• Protein general information: Q8WWQ2  
  • Name: Inactive heparanase 2 (Hpa2)
  • Length: 592  
  • Mass: 66596
  • Tissue specificity: Widely expressed, with the highest expression in brain, mammary gland, prostate, small intestine, testis and uterus. In the central nervous system, expressed in the spinal chord, caudate nucleus, thalamus, substantia nigra, medulla obl
• Sequence:

  MRVLCAFPEAMPSSNSRPPACLAPGALYLALLLHLSLSSQAGDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVN
  ENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDD
  IVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFAL
  NALRRNPNNSWNSSSALSLLKYSASKKYNISWELGNEPNNYRTMHGRAVNGSQLGKDYIQLKSLLQPIRIYSRAS
  LYGPNIGRPRKNVIALLDGFMKVAGSTVDAVTWQHCYIDGRVVKVMDFLKTRLLDTLSDQIRKIQKVVNTYTPGK
  KIWLEGVVTTSAGGTNNLSDSYAAGFLWLNTLGMLANQGIDVVIRHSFFDHGYNHLVDQNFNPLPDYWLSLLYKR
  LIGPKVLAVHVAGLQRKPRPGRVIRDKLRIYAHCTNHHNHNYVRGSITLFIINLHRSRKKIKLAGTLRDKLVHQY
  LLQPYGQEGLKSKSVQLNGQPLVMVDDGTLPELKPRPLRAGRTLVIPPVTMGFYVVKNVNALACRYR

• Structural information:
  • Interpro: IPR005199  IPR017853  
  • STRING: ENSP00000359583
• Other Databases: GeneCards:  HPSE2  Malacards:  HPSE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0030305	heparanase activity	IDA	NOT|molecular function
GO:0031012	extracellular matrix	IDA	cellular component
GO:0043395	heparan sulfate proteoglycan binding	IDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0030305	heparanase activity	TAS	molecular function
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0030305	heparanase activity	TAS	molecular function
GO:0008150	biological_process	ND	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05205	Proteoglycans in cancer
hsa00531	Glycosaminoglycan degradation

Diseases

Associated diseases	References
Urofacial syndrome	KEGG:H00753
Urofacial syndrome	KEGG:H00753
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881