• Gene id: 60490

Gene Summary

• Gene Symbol: PPCDC   Gene   UCSC   Ensembl
• Aliases: MDS018, PPC-DC, coaC
• Gene name: phosphopantothenoylcysteine decarboxylase
• Alternate names: phosphopantothenoylcysteine decarboxylase,
• Gene location: 15q24.2 (75023543: 75060179)     Exons: 10     NC_000015.10
• Gene summary(Entrez): Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopante
• OMIM: 609854

Protein Summary

• Protein general information: Q96CD2  
  • Name: Phosphopantothenoylcysteine decarboxylase (PPC DC) (EC 4.1.1.36) (CoaC)
  • Length: 204  
  • Mass: 22395
• Sequence:

  MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLYSDADE
  WEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITA
  QQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS

• Structural information:
  • Interpro: IPR036551  IPR003382  
  • PDB: 1QZU
  • PDBsum: 1QZU
  • STRING: ENSP00000343190
• Other Databases: GeneCards:  PPCDC  Malacards:  PPCDC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular function
GO:0016831	carboxy-lyase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:0004633	phosphopantothenoylcysteine decarboxylase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:0004633	phosphopantothenoylcysteine decarboxylase activity	IDA	molecular function
GO:0015937	coenzyme A biosynthetic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00770	Pantothenate and CoA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881