• Gene id: 60489

Gene Summary

• Gene Symbol: APOBEC3G   Gene   UCSC   Ensembl
• Aliases: A3G, ARCD, ARP-9, ARP9, CEM-15, CEM15, MDS019, bK150C2.7, dJ494G10.1
• Gene name: apolipoprotein B mRNA editing enzyme catalytic subunit 3G
• Alternate names: DNA dC->dU-editing enzyme APOBEC-3G, APOBEC-related cytidine deaminase, APOBEC-related protein 9, DNA dC->dU editing enzyme, apolipoprotein B editing enzyme catalytic polypeptide-like 3G, apolipoprotein B mRNA editing enzyme cytidine deaminase, apolipoprotein B,
• Gene location: 22q13.1 (39077004: 39087742)     Exons: 7     NC_000022.11
• Gene summary(Entrez): This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fu
• OMIM: 0

Protein Summary

• Protein general information: Q9HC16  
  • Name: DNA dC >dU editing enzyme APOBEC 3G (EC 3.5.4. ) (APOBEC related cytidine deaminase) (APOBEC related protein) (ARCD) (APOBEC related protein 9) (ARP 9) (CEM 15) (CEM15) (Deoxycytidine deaminase) (A3G)
  • Length: 384  
  • Mass: 46408
  • Tissue specificity: Expressed in spleen, testes, ovary and peripheral blood leukocytes and CD4+ lymphocytes. Also expressed in non-permissive peripheral blood mononuclear cells, and several tumor cell lines; no expression detected in permissive lymphoid a
• Sequence:

  MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRFFHWFS
  KWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMK
  IMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVE
  RMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS
  KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
  RAILQNQEN

• Structural information:
  • Protein Domains: (29..13-)
    1 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083-)
    (214..32-)
    2 (/note="CMP/dCMP-type-deaminase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01083"-)
  • Interpro: IPR016192  IPR040551  IPR002125  IPR016193  
  • Prosite: PS00903 PS51747
  • PDB: 2JYW 2KBO 2KEM 3E1U 3IQS 3IR2 3V4J 3V4K 4ROV 4ROW 5ZVA 5ZVB 6BUX 6BWY 6K3J 6K3K
  • PDBsum: 2JYW 2KBO 2KEM 3E1U 3IQS 3IR2 3V4J 3V4K 4ROV 4ROW 5ZVA 5ZVB 6BUX 6BWY 6K3J 6K3K
  • DIP: 37519
  • STRING: ENSP00000385057
• Other Databases: GeneCards:  APOBEC3G  Malacards:  APOBEC3G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045087	innate immune response	IDA	biological process
GO:0004126	cytidine deaminase activity	TAS	molecular function
GO:0030895	apolipoprotein B mRNA editing enzyme complex	TAS	cellular component
GO:0016553	base conversion or substitution editing	TAS	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	biological process
GO:0048525	negative regulation of viral process	IDA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0010529	negative regulation of transposition	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0080111	DNA demethylation	IBA	biological process
GO:0070383	DNA cytosine deamination	IBA	biological process
GO:0047844	deoxycytidine deaminase activity	IBA	molecular function
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA	biological process
GO:0016554	cytidine to uridine editing	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004126	cytidine deaminase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:0010529	negative regulation of transposition	IDA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0070383	DNA cytosine deamination	IDA	biological process
GO:0070383	DNA cytosine deamination	IDA	biological process
GO:0070383	DNA cytosine deamination	IDA	biological process
GO:0047844	deoxycytidine deaminase activity	IDA	molecular function
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	biological process
GO:0045869	negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IDA	biological process
GO:0009972	cytidine deamination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016553	base conversion or substitution editing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004126	cytidine deaminase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)