Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 6045
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol RNF2   Gene   UCSC   Ensembl
Aliases BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Gene name ring finger protein 2
Alternate names E3 ubiquitin-protein ligase RING2, HIP2-interacting protein 3, RING finger protein 1B, RING finger protein BAP-1, RING-type E3 ubiquitin transferase RING2, huntingtin-interacting protein 2-interacting protein 3, protein DinG,
Gene location 1q25.3 (185045429: 185102602)     Exons: 9     NC_000001.11
Gene summary(Entrez) Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been
OMIM 613570

Protein Summary
Protein general information Q99496  

Name: E3 ubiquitin protein ligase RING2 (EC 2.3.2.27) (Huntingtin interacting protein 2 interacting protein 3) (HIP2 interacting protein 3) (Protein DinG) (RING finger protein 1B) (RING1b) (RING finger protein 2) (RING finger protein BAP 1) (RING type E3 ubiqui

Length: 336  Mass: 37655

Sequence MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADC
IITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKI
QAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASE
IELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
Structural information
Interpro:  IPR032443  IPR037937  IPR001841  IPR013083  IPR017907  
Prosite:   PS00518 PS50089

PDB:  		 2H0D 3GS2 3H8H 3IXS 3RPG 4R8P 4S3O
PDBsum:   2H0D 3GS2 3H8H 3IXS 3RPG 4R8P 4S3O

DIP:  
40034
MINT:  
STRING:   ENSP00000356480
Other Databases GeneCards:  RNF2  Malacards:  RNF2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0031519 PcG protein complex
 IBA cellular component
GO:0035518 histone H2A monoubiquitin
ation
 IBA biological process
GO:0000151 ubiquitin ligase complex
 IBA cellular component
GO:0003682 chromatin binding
 IBA molecular function
GO:0061630 ubiquitin protein ligase
activity
 IBA molecular function
GO:0071339 MLL1 complex
 IDA cellular component
GO:0035102 PRC1 complex
 IDA cellular component
GO:0035102 PRC1 complex
 IDA cellular component
GO:0008270 zinc ion binding
 IDA molecular function
GO:0004842 ubiquitin-protein transfe
rase activity
 IDA contributes to
GO:0000151 ubiquitin ligase complex
 IDA cellular component
GO:0035518 histone H2A monoubiquitin
ation
 IDA biological process
GO:0031519 PcG protein complex
 IDA cellular component
GO:0031519 PcG protein complex
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0071535 RING-like zinc finger dom
ain binding
 IPI molecular function
GO:0036353 histone H2A-K119 monoubiq
uitination
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
 ISS biological process
GO:0000151 ubiquitin ligase complex
 IEA cellular component
GO:0035102 PRC1 complex
 IEA cellular component
GO:0071339 MLL1 complex
 IEA cellular component
GO:0031519 PcG protein complex
 IEA cellular component
GO:0036353 histone H2A-K119 monoubiq
uitination
 IEA biological process
GO:0016740 transferase activity
 IEA molecular function
GO:0046872 metal ion binding
 IEA molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0005694 chromosome
 IEA cellular component
GO:0003682 chromatin binding
 IDA molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0070317 negative regulation of G0
to G1 transition
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0061630 ubiquitin protein ligase
activity
 IEA molecular function
GO:0016574 histone ubiquitination
 IEA biological process
GO:0003682 chromatin binding
 IEA molecular function
GO:0001739 sex chromatin
 IEA cellular component
GO:0001702 gastrulation with mouth f
orming second
 IEA biological process
GO:0000792 heterochromatin
 IEA cellular component
GO:0000791 euchromatin
 IEA cellular component
GO:0000278 mitotic cell cycle
 IEA biological process
GO:0000151 ubiquitin ligase complex
 IEA cellular component
GO:0036353 histone H2A-K119 monoubiq
uitination
 IEA biological process
GO:0031519 PcG protein complex
 IEA cellular component
GO:0016604 nuclear body
 IEA cellular component
GO:0010467 gene expression
 IEA biological process
GO:0009948 anterior/posterior axis s
pecification
 IEA biological process
GO:0007281 germ cell development
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0000122 negative regulation of tr
anscription by RNA polyme
rase II
 IEA biological process
GO:0005694 chromosome
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0016604 nuclear body
 IDA cellular component
GO:0016567 protein ubiquitination
 IEA biological process
GO:0005634 nucleus
 IDA cellular component
GO:0005515 protein binding
 IPI molecular function
GO:0043433 negative regulation of DN
A-binding transcription f
actor activity
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

Diseases

Expand All | Collapse All
Associated diseases References
pancreatic ductal carcinoma PMID:19585519
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract