• Gene id: 60437

Gene Summary

• Gene Symbol: CDH26   Gene   UCSC   Ensembl
• Aliases: VR20
• Gene name: cadherin 26
• Alternate names: cadherin-like protein 26, cadherin-like 26, cadherin-like protein VR20,
• Gene location: 20q13.33 (59957763: 60037970)     Exons: 23     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the cadherin protein family. Cadherins are a family of calcium-dependent adhesion molecules that mediate cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization, migration

Protein Summary

• Protein general information: Q8IXH8  
  • Name: Cadherin like protein 26 (Cadherin like protein VR20)
  • Length: 832  
  • Mass: 92416
  • Tissue specificity: Expressed by epithelial cells of gastrointestinal tissue. {ECO
• Sequence:

  MAMRSGRHPSLLLLLVLLLWLLQVSIIDSVQQETDDLTKQTKEKIYQPLRRSKRRWVITTLELEEEDPGPFPKLI
  GELFNNMSYNMSLMYLISGPGVDEYPEIGLFSLEDHENGRIYVHRPVDREMTPSFTVYFDVVERSTGKIVDTSLI
  FNIRISDVNDHAPQFPEKEFNITVQENQSAGQPIFQMLAVDLDEENTPNSQVLYFLISQTPLLKESGFRVDRLSG
  EIRLSGCLDYETAPQFTLLIRARDCGEPSLSSTTTVHVDVQEGNNHRPAFTQENYKVQIPEGRASQGVLRLLVQD
  RDSPFTSAWRAKFNILHGNEEGHFDISTDPETNEGILNVIKPLDYETRPAQSLIIVVENEERLVFCERGKLQPPR
  KAAASATVSVQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNAMDPDSQIRYELVHDPANWVSVDKNSGVVIT
  VEPIDRESPHVNNSFYVIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDP
  DLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASG
  LTCVELADAEVGLHVGALFPVCAAFVALAVALLFLLRCYFVLEPKRHGCSVSNDEGHQTLVMYNAESKGTSAQTW
  SDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIHSTPAYPDATMHRQ
  LLAPVEGRMAETLNQKLHVANVLEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIY
  SESGVPS

• Structural information:
  • Protein Domains: (35..16-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (166..27-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (276..39-)
    (/note="Cadherin-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:-)
  • Interpro: IPR039808  IPR002126  IPR015919  IPR020894  
  • Prosite: PS00232 PS50268
  • STRING: ENSP00000339390
• Other Databases: GeneCards:  CDH26  Malacards:  CDH26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007043	cell-cell junction assembly	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0016342	catenin complex	IBA	cellular component
GO:0000902	cell morphogenesis	IBA	biological process
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005912	adherens junction	IBA	cellular component
GO:0034332	adherens junction organization	IBA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IBA	biological process
GO:0045296	cadherin binding	IBA	molecular function
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	IBA	biological process
GO:0008013	beta-catenin binding	IDA	molecular function
GO:0045294	alpha-catenin binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0035710	CD4-positive, alpha-beta T cell activation	IDA	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0070097	delta-catenin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray