• Gene id: 60436

Gene Summary

• Gene Symbol: TGIF2   Gene   UCSC   Ensembl
• Gene name: TGFB induced factor homeobox 2
• Alternate names: homeobox protein TGIF2, 5'-TG-3' interacting factor 2, TGF(beta)-induced transcription factor 2, TGFB-induced factor 2 (TALE family homeobox), transcription growth factor-beta-induced factor 2,
• Gene location: 20q11.23 (36573472: 36593951)     Exons: 5     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor, which appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and over-expressed in some o
• OMIM: 186760

Protein Summary

• Protein general information: Q9GZN2  
  • Name: Homeobox protein TGIF2 (5' TG 3' interacting factor 2) (TGF beta induced transcription factor 2) (TGFB induced factor 2)
  • Length: 237  
  • Mass: 25878
  • Tissue specificity: Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate.
• Sequence:

  MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRR
  LLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGE
  LESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLL
  HTPIPLVSENPQ

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  
  • Prosite: PS50071
  • CDD: cd00086
  • STRING: ENSP00000362981
• Other Databases: GeneCards:  TGIF2  Malacards:  TGIF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0038092	nodal signaling pathway	IEA	biological process
GO:0010470	regulation of gastrulation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04350	TGF-beta signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881