• Gene id: 6041

Gene Summary

• Gene Symbol: RNASEL   Gene   UCSC   Ensembl
• Aliases: PRCA1, RNS4
• Gene name: ribonuclease L
• Alternate names: 2-5A-dependent ribonuclease, 2',5'-oligoisoadenylate synthetase-dependent, 2-5A-dependent RNase, RNase L, interferon-induced 2-5A-dependent RNase, ribonuclease 4,
• Gene location: 1q25.3 (182589284: 182573633)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candida
• OMIM: 180435

Protein Summary

• Protein general information: Q05823  
  • Name: 2 5A dependent ribonuclease (2 5A dependent RNase) (EC 3.1.26. ) (Ribonuclease 4) (Ribonuclease L) (RNase L)
  • Length: 741  
  • Mass: 83533
  • Tissue specificity: Highly expressed in spleen and thymus followed by prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes.
• Sequence:

  MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIV
  ELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGAN
  VNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLL
  LDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
  CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTS
  EGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRG
  EDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLG
  RLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
  NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDE
  EKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC

• Structural information:
  • Protein Domains: (365..58-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (589..72-)
    (/note="KEN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00725"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR010513  IPR038357   IPR011009  IPR000719  IPR018997  IPR042745  
  • Prosite: PS50297 PS50088 PS51392 PS50011
  • CDD: cd10423
  • PDB: 1WDY 4G8K 4G8L 4OAU 4OAV
  • PDBsum: 1WDY 4G8K 4G8L 4OAU 4OAV
  • DIP: 61367
  • STRING: ENSP00000356530
• Other Databases: GeneCards:  RNASEL  Malacards:  RNASEL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006396	RNA processing	IBA	biological process
GO:0045071	negative regulation of viral genome replication	IBA	biological process
GO:0051607	defense response to virus	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0004540	ribonuclease activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0060338	regulation of type I interferon-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051607	defense response to virus	TAS	biological process
GO:0060337	type I interferon signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045444	fat cell differentiation	IEA	biological process
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0019843	rRNA binding	IEA	molecular function
GO:0016363	nuclear matrix	IEA	cellular component
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0043021	ribonucleoprotein complex binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0004540	ribonuclease activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0004521	endoribonuclease activity	NAS	molecular function
GO:0006468	protein phosphorylation	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05160	Hepatitis C

Diseases

Associated diseases	References
Prostate cancer	PMID:15040862
Prostate cancer	PMID:12415269
Lynch syndrome	PMID:16054567
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)