• Gene id: 604

Gene Summary

• Gene Symbol: BCL6   Gene   UCSC   Ensembl
• Aliases: BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
• Gene name: BCL6 transcription repressor
• Alternate names: B-cell lymphoma 6 protein, B cell CLL/lymphoma 6, B-cell lymphoma 5 protein, B-cell lymphoma 6 protein transcript, BCL-5, BCL-6, cys-his2 zinc finger transcription factor, lymphoma-associated zinc finger gene on chromosome 3, protein LAZ-3, zinc finger and BTB dom,
• Gene location: 3q27.3 (187745471: 187721376)     Exons: 12     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 resp
• OMIM: 109565

Protein Summary

• Protein general information: P41182  
  • Name: B cell lymphoma 6 protein (BCL 6) (B cell lymphoma 5 protein) (BCL 5) (Protein LAZ 3) (Zinc finger and BTB domain containing protein 27) (Zinc finger protein 51)
  • Length: 706  
  • Mass: 78846
  • Tissue specificity: Expressed in germinal center T- and B-cells and in primary immature dendritic cells. {ECO
• Sequence:

  MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKCNLSVINLD
  PEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIKASEAEMVSAIKPPREEFLNSRMLM
  PQDIMAYRGREVVENNLPLRSAPGCESRAFAPSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFP
  KERALPCDSARPVPGEYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
  KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAKSPTDPKACNW
  KKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQASRLNNIV
  NRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDC
  RFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
  PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRL
  HLRQKHGAITNTKVQYRVSATDLPPELPKAC

• Structural information:
  • Protein Domains: (32..9-)
    (/note="BTB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00037"-)
  • Interpro: IPR000210  IPR011333  IPR036236  IPR013087  
  • Prosite: PS50097 PS00028 PS50157
  • PDB: 1R28 1R29 1R2B 2EN2 2EOS 2LCE 2YRM 3BIM 3E4U 3LBZ 4CP3 4U2M 5H7G 5H7H 5MW2 5MW6 5MWD 5N1X 5N1Z 5N20 5N21 5X4M 5X4N 5X4O 5X4P 5X4Q 5X9O 5X9P 6C3L 6C3N 6CQ1 6EW6 6EW7 6EW8
  • PDBsum: 1R28 1R29 1R2B 2EN2 2EOS 2LCE 2YRM 3BIM 3E4U 3LBZ 4CP3 4U2M 5H7G 5H7H 5MW2 5MW6 5MWD 5N1X 5N1Z 5N20 5N21 5X4M 5X4N 5X4O 5X4P 5X4Q 5X9O 5X9P 6C3L 6C3N 6CQ1 6EW6 6EW7 6EW8
  • DIP: 2651
  • STRING: ENSP00000384371
• Other Databases: GeneCards:  BCL6  Malacards:  BCL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0002682	regulation of immune system process	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0050727	regulation of inflammatory response	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0042092	type 2 immune response	IBA	biological process
GO:0045595	regulation of cell differentiation	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051272	positive regulation of cellular component movement	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0048821	erythrocyte development	IEA	biological process
GO:0048294	negative regulation of isotype switching to IgE isotypes	IEA	biological process
GO:0045746	negative regulation of Notch signaling pathway	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045629	negative regulation of T-helper 2 cell differentiation	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043380	regulation of memory T cell differentiation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007266	Rho protein signal transduction	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0002829	negative regulation of type 2 immune response	IEA	biological process
GO:0001953	negative regulation of cell-matrix adhesion	IEA	biological process
GO:0001161	intronic transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000902	cell morphogenesis	IEA	biological process
GO:2000773	negative regulation of cellular senescence	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0042092	type 2 immune response	IEA	biological process
GO:0035024	negative regulation of Rho protein signal transduction	IEA	biological process
GO:0032764	negative regulation of mast cell cytokine production	IEA	biological process
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0031065	positive regulation of histone deacetylation	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002467	germinal center formation	IEA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005657	replication fork	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0050776	regulation of immune response	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	NAS	biological process
GO:0003700	DNA-binding transcription factor activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002903	negative regulation of B cell apoptotic process	NAS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0002634	regulation of germinal center formation	NAS	biological process
GO:1903464	negative regulation of mitotic cell cycle DNA replication	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa04068	FoxO signaling pathway

Diseases

Associated diseases	References
Hairy cell leukemia	KEGG:H00006
Hairy cell leukemia	KEGG:H00006
diffuse large B-cell lymphoma	PMID:15701085
diffuse large B-cell lymphoma	PMID:11821949
B-cell lymphoma	PMID:11821949
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray