• Gene id: 6039

Gene Summary

• Gene Symbol: RNASE6   Gene   UCSC   Ensembl
• Aliases: RAD1, RNS6, RNasek6
• Gene name: ribonuclease A family member k6
• Alternate names: ribonuclease K6, ribonuclease A D1, ribonuclease, RNase A family, k6, testicular tissue protein Li 166,
• Gene location: 14q11.2 (20780955: 20782466)     Exons: 4     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the ribonuclease A superfamily and functions in the urinary tract. The protein has broad-spectrum antimicrobial activity against pathogenic bacteria. [provided by RefSeq, Nov 2014]
• OMIM: 601981

Protein Summary

• Protein general information: Q93091  
  • Name: Ribonuclease K6 (RNase K6) (EC 3.1.27. )
  • Length: 150  
  • Mass: 17196
  • Tissue specificity: Highly expressed in spleen (at protein level) (PubMed
• Sequence:

  MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVA
  AVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

• Structural information:
  • Interpro: IPR001427  IPR036816  IPR023411  IPR023412  
  • Prosite: PS00127
  • PDB: 4X09 5OAB 6ENP 6MV6 6MV7
  • PDBsum: 4X09 5OAB 6ENP 6MV6 6MV7
  • STRING: ENSP00000302046
• Other Databases: GeneCards:  RNASE6  Malacards:  RNASE6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0042742	defense response to bacterium	IEA	biological process
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006401	RNA catabolic process	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IDA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051607	defense response to virus	IDA	NOT|biological process
GO:0051607	defense response to virus	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881