Search Result
Gene id | 60386 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | SLC25A19 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | DNC, MCPHA, MUP1, THMD3, THMD4, TPC | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | solute carrier family 25 member 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | mitochondrial thiamine pyrophosphate carrier, mitochondrial uncoupling protein 1, solute carrier family 25 (mitochondrial deoxynucleotide carrier), member 19, solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
17q25.1 (75289957: 75272979) Exons: 11 NC_000017.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a mitochondrial protein that is a member of the solute carrier family. Although this protein was initially thought to be the mitochondrial deoxynucleotide carrier involved in the uptake of deoxynucleotides into the matrix of the mitochon |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 606707 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9HC21 Name: Mitochondrial thiamine pyrophosphate carrier (Mitochondrial uncoupling protein 1) (Solute carrier family 25 member 19) Length: 320 Mass: 35511 Tissue specificity: Expressed in all tissues examined except for placenta. Highest levels in colon, kidney, lung, testis, spleen, and brain. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGP TAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQG EPKVYNTLRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSG AGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMF FSYEFFCNVFHCMNRTASQR | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: SLC25A19 Malacards: SLC25A19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|