• Gene id: 60385

Gene Summary

• Gene Symbol: TSKS   Gene   UCSC   Ensembl
• Aliases: PPP1R161, STK22S1, TSKS1, TSSKS
• Gene name: testis specific serine kinase substrate
• Alternate names: testis-specific serine kinase substrate, STK22 substrate 1, protein phosphatase 1, regulatory subunit 161, testis specific serine/threonine kinase substrate, testis-specific kinase substrate,
• Gene location: 19q13.33 (49763327: 49739752)     Exons: 12     NC_000019.10
• Gene summary(Entrez): This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS vi
• OMIM: 608253

Protein Summary

• Protein general information: Q9UJT2  
  • Name: Testis specific serine kinase substrate (Testis specific kinase substrate) (STK22 substrate 1)
  • Length: 592  
  • Mass: 65050
  • Tissue specificity: Highly expressed in testis. Expressed at low levels in prostate, female breast, placenta, ovary and thymus. {ECO
• Sequence:

  MASVVVKTIWQSKEIHEAGDTPTGVESCSQLVPEAPRRVTSRAKGIPKKKKAVSFHGVEPQMSHQPMHWCLNLKR
  SSACTNVSLLNLAAMEPTDSTGTDSTVEDLSGQLTLAGPPASPTLPWDPDDADITEILSGVNSGLVRAKDSITSL
  KEKTNRVNQHVQSLQSECSVLSENLERRRQEAEELEGYCIQLKENCWKVTRSVEDAEIKTNVLKQNSALLEEKLR
  YLQQQLQDETPRRQEAELQEPEEKQEPEEKQEPEEKQKPEAGLSWNSLGPAATSQGCPGPPGSPDKPSRPHGLVP
  AGWGMGPRAGEGPYVSEQELQKLFTGIEELRREVSSLTARWHQEEGAVQEALRLLGGLGGRVDGFLGQWERAQRE
  QAQTARDLQELRGRADELCTMVERSAVSVASLRSELEGLGPLKPILEEFGRQFQNSRRGPDLSMNLDRSHQGNCA
  RCASQGSQLSTESLQQLLDRALTSLVDEVKQRGLTPACPSCQRLHKKILELERQALAKHVRAEALSSTLRLAQDE
  ALRAKNLLLTDKMKPEEKMATLDHLHLKMCSLHDHLSNLPLEGSTGTMGGGSSAGTPPKQGGSAPEQ

• Structural information:
  • Interpro: IPR028214  
  • STRING: ENSP00000246801
• Other Databases: GeneCards:  TSKS  Malacards:  TSKS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005814	centriole	IBA	cellular component
GO:0019901	protein kinase binding	IBA	molecular function
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005814	centriole	IEA	cellular component
GO:0005814	centriole	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R