• Gene id: 6037

Gene Summary

• Gene Symbol: RNASE3   Gene   UCSC   Ensembl
• Aliases: ECP, RAF1, RNS3
• Gene name: ribonuclease A family member 3
• Alternate names: eosinophil cationic protein, RNase 3, cytotoxic ribonuclease, ribonuclease 3, ribonuclease, RNase A family, 3,
• Gene location: 14q11.2 (20891402: 20892347)     Exons: 2     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein exhibits antimicrobial activity against pathogenic bacteria [provided by RefSeq, Oct 2014]
• OMIM: 604062

Protein Summary

• Protein general information: P12724  
  • Name: Eosinophil cationic protein (ECP) (EC 3.1.27. ) (Ribonuclease 3) (RNase 3)
  • Length: 160  
  • Mass: 18385
• Sequence:

  MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTF
  ANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYP
  VVPVHLDTTI

• Structural information:
  • Interpro: IPR001427  IPR036816  IPR023411  IPR023412  
  • Prosite: PS00127
  • PDB: 1DYT 1H1H 1QMT 2KB5 2LVZ 4A2O 4A2Y 4OWZ 4OXB 4OXF 4X08
  • PDBsum: 1DYT 1H1H 1QMT 2KB5 2LVZ 4A2O 4A2Y 4OWZ 4OXB 4OXF 4X08
  • STRING: ENSP00000302324
• Other Databases: GeneCards:  RNASE3  Malacards:  RNASE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006401	RNA catabolic process	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0043152	induction of bacterial agglutination	IDA	biological process
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006401	RNA catabolic process	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0019731	antibacterial humoral response	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0002227	innate immune response in mucosa	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0050829	defense response to Gram-negative bacterium	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0043152	induction of bacterial agglutination	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05310	Asthma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881