• Gene id: 6036

Gene Summary

• Gene Symbol: RNASE2   Gene   UCSC   Ensembl
• Aliases: EDN, RAF3, RNS2
• Gene name: ribonuclease A family member 2
• Alternate names: non-secretory ribonuclease, RNase 2, RNase UpI-2, eosinophil-derived neurotoxin, ribonuclease 2, ribonuclease A F3, ribonuclease US, ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin),
• Gene location: 14q11.2 (45833417: 45843275)     Exons: 8     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses. [provided by RefSeq, Oct 2014]
• OMIM: 131410

Protein Summary

• Protein general information: P10153  
  • Name: Non secretory ribonuclease (EC 4.6.1.18) (Eosinophil derived neurotoxin) (RNase UpI 2) (Ribonuclease 2) (RNase 2) (Ribonuclease US)
  • Length: 161  
  • Mass: 18354
  • Tissue specificity: Liver, lung, spleen, leukocytes and body fluids.
• Sequence:

  MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTF
  ANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQY
  PVVPVHLDRII

• Structural information:
  • Interpro: IPR001427  IPR036816  IPR023411  IPR023412  
  • Prosite: PS00127
  • PDB: 1GQV 1HI2 1HI3 1HI4 1HI5 1K2A 2BEX 2BZZ 2C01 2C02 2C05 5E13
  • PDBsum: 1GQV 1HI2 1HI3 1HI4 1HI5 1K2A 2BEX 2BZZ 2C01 2C02 2C05 5E13
  • STRING: ENSP00000303276
• Other Databases: GeneCards:  RNASE2  Malacards:  RNASE2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004540	ribonuclease activity	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0004540	ribonuclease activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0006401	RNA catabolic process	TAS	biological process
GO:0004522	ribonuclease A activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0051607	defense response to virus	IDA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0090501	RNA phosphodiester bond hydrolysis	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050830	defense response to Gram-positive bacterium	IMP	NOT|biological process
GO:0001530	lipopolysaccharide binding	IMP	NOT|molecular function
GO:0043152	induction of bacterial agglutination	IMP	NOT|biological process
GO:0050829	defense response to Gram-negative bacterium	IMP	NOT|biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881