• Gene id: 60343

Gene Summary

• Gene Symbol: FAM3A   Gene   UCSC   Ensembl
• Aliases: 2.19, DLD, DXS560S, XAP-7
• Gene name: FAM3 metabolism regulating signaling molecule A
• Alternate names: protein FAM3A, cytokine-like protein 2-19, family with sequence similarity 3 member A,
• Gene location: Xq28 (154516256: 154506158)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing re
• OMIM: 607695

Protein Summary

• Protein general information: P98173  
  • Name: Protein FAM3A (Cytokine like protein 2 19)
  • Length: 230  
  • Mass: 25152
  • Tissue specificity: In similar amounts in testis, pancreas, adrenal, placenta, brain, fetal brain, liver, kidney, skeletal muscle and heart.
• Sequence:

  MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVV
  SGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPLHEGTLVFVAS
  YDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPR
  RSTAS

• Structural information:
  • Interpro: IPR039220  IPR039221  IPR039477  IPR039475  
  • CDD: cd13940
  • STRING: ENSP00000320521
• Other Databases: GeneCards:  FAM3A  Malacards:  FAM3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045721	negative regulation of gluconeogenesis	IEA	biological process
GO:0046890	regulation of lipid biosynthetic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0019732	antifungal humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:1905035	negative regulation of antifungal innate immune response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0019732	antifungal humoral response	IDA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq