About Us

Search Result


Gene id 60312
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol AFAP1   Gene   UCSC   Ensembl
Aliases AFAP, AFAP-110, AFAP110
Gene name actin filament associated protein 1
Alternate names actin filament-associated protein 1, 110 kDa actin filament-associated protein, actin filament-associated protein, 110 kDa,
Gene location 4p16.1 (7939925: 7758712)     Exons: 21     NC_000004.12
Gene summary(Entrez) The protein encoded by this gene is a Src binding partner. It may represent a potential modulator of actin filament integrity in response to cellular signals, and may function as an adaptor protein by linking Src family members and/or other signaling prot
OMIM 300492

Protein Summary

Protein general information Q8N556  

Name: Actin filament associated protein 1 (110 kDa actin filament associated protein) (AFAP 110)

Length: 730  Mass: 80725

Tissue specificity: Low expression in normal breast epithelial cell line MCF-10A and in tumorigenic breast cancer cell lines MCF-7, T-47D and ZR-75-1. Highly expressed in the invasive breast cancer cell lines MDA-MB-231 and MDA-MB-435. Overexpressed in pr

Sequence MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEIPQPWL
PPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQWPSEEASMDL
VKDAKICAFLLRKKRFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCNITYIPKDSKKKKHELKITQQGTD
PLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGVVENGITTCNGKE
QVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPTCGYLNVLSNSRWRERWCRVKDNKLI
FHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAVLEASSSEDMGRWIGILLAETGSSTDPEALH
YDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNGYAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTG
KGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRVEADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIE
VNAGRKPQAILEEKLKQLEEECRQKEAERVSLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRT
LENSPISSCDTSDTEGPVPVNSAAVLKKSQAAPGSSPCRGHVLRKAKEWELKNGT
Structural information
Protein Domains
(153..24-)
(/note="PH-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
(347..44-)
(/note="PH-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
Interpro:  IPR030113  IPR029907  IPR011993  IPR001849  
Prosite:   PS50003
STRING:   ENSP00000410689
Other Databases GeneCards:  AFAP1  Malacards:  AFAP1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0042169 SH2 domain binding
IBA molecular function
GO:0005829 cytosol
IBA cellular component
GO:0017124 SH3 domain binding
IBA molecular function
GO:0051493 regulation of cytoskeleto
n organization
IEA biological process
GO:0009966 regulation of signal tran
sduction
IEA biological process
GO:0003779 actin binding
IEA molecular function
GO:0005856 cytoskeleton
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005925 focal adhesion
IDA cellular component
GO:0005829 cytosol
IDA cellular component
GO:0015629 actin cytoskeleton
IDA cellular component
GO:0005925 focal adhesion
HDA cellular component
Associated diseases References
open-angle glaucoma PMID:25173105
Cryptorchidism MIK: 28606200

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract